spacer

EBI Dbfetch

ID   AJ310358; SV 1; linear; genomic DNA; STD; HUM; 3370 BP.
XX
AC   AJ310358;
XX
DT   10-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*3701 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*3701 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3370
RA   Cox S.T.;
RT   ;
RL   Submitted (10-APR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*3701";
RL   Unpublished.
XX
DR   MD5; 9db7899405a32f83e09b8cc9877ca072.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3370
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<302..374,504..773,1020..1295,1868..2143,2248..2364,
FT                   2806..2838,2945..>2988)
FT                   /gene="HLA-B"
FT   CDS             join(302..374,504..773,1020..1295,1868..2143,2248..2364,
FT                   2806..2838,2945..2988)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presetating molecule"
FT                   /note="B*3701 allele"
FT                   /db_xref="GOA:P18463"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*37:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18463"
FT                   /protein_id="CAC38763.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRT
FT                   LLRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*3701 allele"
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*3701 allele"
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*3701 allele"
FT   intron          774..1019
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*3701 allele"
FT   exon            1020..1295
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*3701 allele"
FT   intron          1296..1867
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*3701 allele"
FT   exon            1868..2143
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*3701 allele"
FT   intron          2144..2247
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*3701 allele"
FT   exon            2248..2364
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*3701 allele"
FT   intron          2365..2805
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*3701 allele"
FT   exon            2806..2838
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*3701 allele"
FT   intron          2839..2944
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*3701 allele"
FT   exon            2945..2988
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*3701 allele"
XX
SQ   Sequence 3370 BP; 624 A; 986 C; 1054 G; 706 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggccc cgggcggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc attggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gctggtgagt gcggggtcgg cagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttccaca cctccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag gacctgcgga ccctgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcccccctg aggccgcggg acccgcccag accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg gacggggctg accgcggggc cggggccagg      1020
     gtctcacacc atccagagga tgtctggctg cgacgtgggg ccggacgggc gcctcctccg      1080
     cgggtataac cagttcgcct acgacggcaa ggattacatc gccctgaacg aggacctgag      1140
     ctcctggacc gcggcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg      1200
     tgtggcggag caggacagag cctacctgga gggcacgtgc gtggagtggc tccgcagata      1260
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1320
     cccatctcct ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca      1380
     gcgctagaat gtcgccctcc cttgaatgga gaatggcatg agttttcctg agtttcctct      1440
     gagggccccc tcttctctct aggacaatta agggatgacg tctctgagga aatggagggg      1500
     aagacagtcc ctagaatact gatcaggggt cccctttgac ccctgcagca gccttgggaa      1560
     ccatgacttt tcctctcagg ccttgttctc tgcctcacac tcagtgtgtt tggggctctg      1620
     attccagcac ttctgagtca ctttacctcc actcagatca ggagcagaag tctctgttcc      1680
     ccgctcagag actcgaactt tccaatgaat agattatccc aggtgcctgc gtccaggctg      1740
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1800
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1860
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc      1920
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1980
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      2040
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      2100
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      2160
     gggtcatatc tcttctcagg gaaagcagga gcccttctgg agcccttcag cagggtcagg      2220
     acccctcatc ttcccctcct ttcccagagc catcttccca gtccaccatc cccatcgtgg      2280
     gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctactg      2340
     tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgggttttct      2400
     tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc      2460
     agcatccaca caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt      2520
     gcagcacatg tgacaatgaa ggacggatgt atcaccttga tggttgtggt gttggggtcc      2580
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2640
     gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgcctt gggtctgtag      2700
     tcatacttct ggaaattcct tttggttcca agacgaggag gttcctctaa gatctcatgg      2760
     ccctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga aaaggaggga      2820
     gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct cacccacccc      2880
     ataattcctc ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt ttgttctact      2940
     ccagccagcg acagtgccca gggctctgat gtgtctctca cagcttgaaa aggtgagatt      3000
     cttggggtct agagtgggcg ggggggcggg gagggggcag aggggaaagg cctgggtaat      3060
     ggagattctt tgattgggat gtttcgcgtg tgtggtgggc tgttcagagt gtcatcactt      3120
     accatgacta accagaattt gttcatgact gttgttttct gtagcctgag acagctgtct      3180
     tgtgagggac tgagatgcag gatttcttca cgcctcccct ttgtgacttc aagagcctct      3240
     ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc cctgttagca taatgtgagg      3300
     aggtggagag acagcccacc cccgtgtcca ctgtgacccc tgttcgcatg ctgacctgtg      3360
     tttcctcccc                                                             3370
//


spacer
spacer