spacer

EBI Dbfetch

ID   AJ309979; SV 1; linear; genomic DNA; STD; HUM; 3372 BP.
XX
AC   AJ309979;
XX
DT   10-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*1803 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*1803 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3372
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (02-MAR-2001) to the INSDC.
RL   Dunn P.P.J., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P.J.;
RT   "Complete nucleotide sequencing of HLA class I genes";
RL   Unpublished.
XX
DR   MD5; 16873a72964cafbba426ee3a41053c74.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3372
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(309..381,510..779,1026..1301,1874..2149,2254..2370,
FT                   2812..2844,2951..2994)
FT                   /gene="HLA-B"
FT   CDS             join(309..381,510..779,1026..1301,1874..2149,2254..2370,
FT                   2812..2844,2951..2994)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*1803 allele"
FT                   /db_xref="GOA:P30466"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*18:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:4JQV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30466"
FT                   /protein_id="CAC34305.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     309..381
FT                   /gene="HLA-B"
FT   exon            309..381
FT                   /gene="HLA-B"
FT                   /number=1
FT   intron          382..509
FT                   /gene="HLA-B"
FT                   /number=1
FT   mat_peptide     join(510..779,1026..1301,1874..2149,2254..2370,2812..2844,
FT                   2951..2994)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   exon            510..779
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          780..1025
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            1026..1301
FT                   /gene="HLA-B"
FT                   /number=3
FT   intron          1302..1873
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1874..2149
FT                   /gene="HLA-B"
FT                   /number=4
FT   intron          2150..2253
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2254..2370
FT                   /gene="HLA-B"
FT                   /number=5
FT   intron          2371..2811
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            2812..2844
FT                   /gene="HLA-B"
FT                   /number=6
FT   intron          2845..2950
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            2951..2994
FT                   /gene="HLA-B"
FT                   /number=7
XX
SQ   Sequence 3372 BP; 626 A; 988 C; 1059 G; 699 T; 0 other;
     aagaggctgg tgtaggagaa gagggatcag gacgaagtcc caggccccgg gcggggctct        60
     cagggtctca ggctccgaga gccttgtctg cattggggag gcgcagcatt ggggattccc       120
     cactcccacg agtttcactt cttctcccaa cctatgtcgg gtccttcttc caggatactc       180
     gtgacgcgtc cccatttccc actcccattg ggtgtcgggt gtctagagaa gccaatcagt       240
     gtcgccgggg tcccagttct aaagtcccca cgcacccacc cggactcaga atctcctcag       300
     acgccgagat gcgggtcacg gcgccccgaa ccctcctcct gctgctctgg ggggcagtgg       360
     ccctgaccga gacctgggct ggtgagtgcg gggtcggcag ggaaatggcc tctgtgggga       420
     ggagcgaggg gaccgcaggc gggggcgcag gacccgggga gccgcgccgg gaggagggtc       480
     gggcgggtct cagcccctcc ttgccccagg ctcccactcc atgaggtatt tccacacctc       540
     cgtgtcccgg cccggccgcg gggagccccg cttcatctca gtgggctacg tggacggcac       600
     ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg acggagcccc gggcgccgtg       660
     gatagagcaa gaggggccgg agtattggga ccggaacaca cagatctcca agaccaacac       720
     acagactgac cgagagagcc tgcggaacct gcgcggctac tacaaccaga gcgaggccgg       780
     tgagtgaccc cggcccgggg cgcaggtcac gactccccat cccccacgta cggcccgggt       840
     cgccccgagt ctccgggtcc gagatccgcc cccctgaggc cgcgggaccc gcccagaccc       900
     tcgaccggcg agagccccag gcgcgtttac ccggtttcat tttcagttga ggccaaaatc       960
     cccgcgggtt ggtcggggcg gggcggggct cggggggacg gggctgaccg cggggccggg      1020
     gccagggtct cacaccctcc agaggatgta cggctgcgac gtggggccgg acgggcgcct      1080
     cctccgcggg catgaccagt ccgcctacga cggcaaggat tacatcgccc tgaacgagga      1140
     cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca agtgggaggc      1200
     ggcccgtgtg gcggagcagc tgagagccta cctggagggc acgtgcgtgg agtggctccg      1260
     cagacacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga      1320
     gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag gaggaaaatg      1380
     ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt ttcccgagtt      1440
     tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc tgaggaaatg      1500
     gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct      1560
     tgggaaccat gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg      1620
     gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag cagaagtctc      1680
     tgttccccgc tcagagactc gaactttcca atgaatagat tatcccaggt gcctgcgtcc      1740
     aggctggtgt ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc attctcaggc      1800
     tggtcacatg ggtggtccta gggtgtccca tgagagatgc aaagcgcctg aattttctga      1860
     ctcttcccat cagacccccc aaagacacat gtgacccacc accccatctc tgaccatgag      1920
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag      1980
     cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc agcaggagat      2040
     agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacaca      2100
     tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatgggg taaggagggg      2160
     gatgaggggt catatctctt ctcagggaaa gcaggagccc ttctggagcc cttcagcagg      2220
     gtcagggccc ctcatcttcc cctcctttcc cagagccatc ttcccagtcc accatcccca      2280
     tcgtgggcat tgttgctggc ctggctgtcc tagcagttgt ggtcatcgga gctgtggtcg      2340
     ctactgtgat gtgtaggagg aagagctcag gtagggaagg ggtgaggggt ggggtctggg      2400
     ttttcttgtc ccactggggg tttcaagccc caggtagaag tgttccctgc ctcattactg      2460
     ggaagcagca tccacacagg ggctaacgca gcctgggacc ctgtgtgcca gcacttactc      2520
     ttttgtgcag cacatgtgac aatgaaggac ggatgtatca ccttgatggt tgtggtgttg      2580
     gggtcctgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg      2640
     agggcagttg gtccaggacc cacacttgct ttcctcgtgt ttcctgatcc tgccttgggt      2700
     ctgtagtcat acttctggaa attccttttg gttccaagac gaggaggttc ctctaagatc      2760
     tcatggccct gcttcctccc agtcccctca caggacattt tcttcccaca ggtggaaaag      2820
     gagggagcta ctctcaggct gcgtgtaagt ggtgggggtg ggagtgtgga ggagctcacc      2880
     caccccataa ttcctcctgt cccacgtctc ctgcgggctc tgaccaggtc ctgtttttgt      2940
     tctactccag ccagcgacag tgcccagggc tctgatgtgt ctctcacagc ttgaaaaggt      3000
     gagattcttg gggtctagag tgggcggggg ggcggggagg gggcagaggg gaaaggcctg      3060
     ggtaatggag attctttgat tgggatgttt cgcgtgtgtg gtgggctgtt cagagtgtca      3120
     tcacttacca tgactaacca gaatttgttc atgactgttg ttttctgtag cctgagacag      3180
     ctgtcttgtg agggaccgag atgcaggatt tcttcacgcc tcccctttgt gacttcaaga      3240
     gcctctggca tctctttctg caaaggcacc tgaatgtgtc tgcgtccctg ttagcataat      3300
     gtgaggaggt ggagagacag cccacccccg tgtccaccgt gacccctgtt cccatgctga      3360
     cctgtgtttc ct                                                          3372
//


spacer
spacer