spacer

EBI Dbfetch

ID   AJ309937; SV 1; linear; genomic DNA; STD; HUM; 3350 BP.
XX
AC   AJ309937;
XX
DT   10-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*4409 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*4409 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3350
RA   Dunn P.P.J.;
RT   ;
RL   Submitted (02-MAR-2001) to the INSDC.
RL   Dunn P.P.J., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol, BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.P.J.;
RT   "Complete nucleotide sequencing of HLA class I genes";
RL   Unpublished.
XX
DR   MD5; dfe29b0d84df28369d05566d30af99dd.
DR   Ensembl-Gn; ENSG00000228964; homo_sapiens.
DR   Ensembl-Tr; ENST00000421349; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3350
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(318..390,520..789,1033..1308,1884..2159,2253..2369,
FT                   2811..2843,2950..2993)
FT                   /gene="HLA-B"
FT   CDS             join(318..390,520..789,1033..1308,1884..2159,2253..2369,
FT                   2811..2843,2950..2993)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*44009 allele"
FT                   /db_xref="GOA:P30481"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*44:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1M6O"
FT                   /db_xref="PDB:1N2R"
FT                   /db_xref="PDB:1SYS"
FT                   /db_xref="PDB:1SYV"
FT                   /db_xref="PDB:3DX6"
FT                   /db_xref="PDB:3DX7"
FT                   /db_xref="PDB:3DX8"
FT                   /db_xref="PDB:3DXA"
FT                   /db_xref="PDB:3KPL"
FT                   /db_xref="PDB:3KPM"
FT                   /db_xref="PDB:3KPN"
FT                   /db_xref="PDB:3KPO"
FT                   /db_xref="PDB:3KPP"
FT                   /db_xref="PDB:3KPQ"
FT                   /db_xref="PDB:3KPR"
FT                   /db_xref="PDB:3KPS"
FT                   /db_xref="PDB:3L3D"
FT                   /db_xref="PDB:3L3G"
FT                   /db_xref="PDB:3L3I"
FT                   /db_xref="PDB:3L3J"
FT                   /db_xref="PDB:3L3K"
FT                   /db_xref="PDB:4JQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30481"
FT                   /protein_id="CAC33892.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   VTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mat_peptide     join(318..390,520..789,1033..1308,1884..2159,2253..2369,
FT                   2811..2843,2950..2993)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   sig_peptide     318..390
FT                   /gene="HLA-B"
FT   exon            318..390
FT                   /gene="HLA-B"
FT                   /number=1
FT   intron          391..519
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            520..789
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          790..1032
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            1033..1308
FT                   /gene="HLA-B"
FT                   /number=3
FT   intron          1309..1883
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1884..2159
FT                   /gene="HLA-B"
FT                   /number=4
FT   intron          2160..2252
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2253..2369
FT                   /gene="HLA-B"
FT                   /number=5
FT   intron          2370..2810
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            2811..2843
FT                   /gene="HLA-B"
FT                   /number=6
FT   intron          2844..2949
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            2950..2993
FT                   /gene="HLA-B"
FT                   /number=7
XX
SQ   Sequence 3350 BP; 625 A; 961 C; 1070 G; 694 T; 0 other;
     agtgtgacaa agaggctggt gtaggagaag agggatcagg acgaagtccc aggtcccgga        60
     cggggctctc agggtctcag gctccgaggg ccgcgtctgc aatggggagg cgcagcgttg       120
     gggattcccc actcccacga gtttcacttc ttctcccaac ctatgtcggg tccttcttcc       180
     aggatactcg tgacgcgtcc ccatttccca ctcccattgg gtgtcgggtg tctagagaag       240
     ccaatcagtg tcgccggggt cccagttcta aagtccccac gcacccaccc ggactcagaa       300
     tctcctcaga cgccgagatg cgggtcacgg cgccccgaac cctcctcctg ctgctctggg       360
     gggcagtggc cctgaccgag acctgggccg gtgagtgcgg ggtcgggagg gaaatggcct       420
     ctgtggggag gagagagggg accgcaggcg ggggcgcagg acccggggag ccgcgccggg       480
     aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt       540
     tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcacc gtgggctacg       600
     tggacgacac gctgttcgtg aggttcgaca gcgacgccac gagtccgagg aaggagccgc       660
     gggcgccatg gatagagcag gaggggccgg agtattggga ccgggagaca cagatctcca       720
     agaccaacac acagacttac cgagagagcc tgcggaacct gcgcggctac tacaaccaga       780
     gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gactccccat cccccacgta       840
     cggcccgggt cgccccgagt ctccgggtcc gagatccgcc cccgaggccg cgggacccgc       900
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       960
     ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg ggggacgggg ctgaccgcgg      1020
     ggccggggcc agggtctcac atcatccaga ggatgtacgg ctgcgacgtg gggccggacg      1080
     ggcgcctcct ccgcgggtat gaccaggacg cctacgacgg caaggattac atcgccctga      1140
     acgaggacct gagctcctgg accgcggcgg acaccgcggc tcagatcacc cagcgcaagt      1200
     gggaggcggc ccgtgtggcg gagcaggaca gagcctacct ggagggcctg tgcgtggagt      1260
     cgctccgcag atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca      1320
     gtggggagcc ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggag      1380
     gaaaatggga tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc      1440
     ctgagtttcc tctgagggcc ccctcttctc tctaggacaa ttaagggatg acgtctctga      1500
     ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca      1560
     gcagccttgg gaaccgtgac ttttcctctc aggccttgtt ctctgcctca cactcagtgt      1620
     gtttggggct ctgattccag cacttctgag tcactttacc tccactcaga tcaggagcag      1680
     aagtccctgt tccccgctca gagactcgaa ctttccaatg aataggagat tatcccaggt      1740
     gcctgcgtcc aggctggtgt ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc      1800
     attctcaggc tggtcacatg ggtggtccta gggtgtccca tgagagatgc aaagcgcctg      1860
     aattttctga ctcttcccat cagacccccc aaagacacat gtgacccacc accccatctc      1920
     tgaccatgag gtcaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact      1980
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc      2040
     agcaggagat agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca      2100
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatgggg      2160
     taaggagggg gatgaggggt catatctctt ctcagggaaa gcaggagccc ttcagcaggg      2220
     tcagggcccc tcatcttccc ttcctttccc agagccgtct tcccagtcca ccgtccccat      2280
     cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag ctgtggtcgc      2340
     tgctgtgatg tgtaggagga agagctcagg tagggaaggg gtgaggggtg gggtctgggt      2400
     tttcttgtcc cactgggggt ttcaagcccc aggtagaagt gttccctgcc tcattactgg      2460
     gaagcagcat ccacacaggg gctaacgcag cctgggaccc tgtgtgccag cacttactct      2520
     tttgtgcagc acatgtgaca atgaaggacg gatgtatcac cttggtggtt gtggtgttgg      2580
     ggtcctgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca gaccttagga      2640
     gggcagttgg tccaggaccc acacttgctt tcctcgtgtt tcctgatcct gccttgggtc      2700
     tgtagtcata cttctggaaa ttccttttgg gtccaagacg aggaggttcc tctaagatct      2760
     catggccctg cttcctccca gtcccctcac agggcatttt cttcccacag gtggaaaagg      2820
     agggagctac tctcaggctg cgtgtaagtg atgggggcgg gagtgtggag gagctcaccc      2880
     accccataat tcctcctgtc ccacgtctcc tgcgggctct gaccaggtcc tgtttttgtt      2940
     ctactccagg cagcgacagt gcccagggct ctgatgtgtc tctcacagct tgaaaaggtg      3000
     agattcttgg ggtctagagt gggtggggtg gcaggtctgg gggtgggtgg ggcagtgggg      3060
     aaaggcctgg gtaatggaga ttctttgatt gggatgtttc gcgtgtgtgg tgggctgttt      3120
     agagtgtcat cacttaccat gactaaccag aatttgttca tgactgttgt tttctgtagc      3180
     ctgagacagc tgtcttgtga gggactgaga tgcaggattt cttcacgcct cccctttgtg      3240
     acttcaagag cctctggcat ctctttctgc aaaggcacct gaatgtgtct gcgtccctgt      3300
     tagcataatg tgaggaggtg gagagacagc ccacccccgt gtccaccgtg                 3350
//


spacer
spacer