spacer

EBI Dbfetch

ID   AJ309930; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ309930;
XX
DT   01-MAR-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, DRB1*0816 allele, exon
DE   2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0816 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (27-FEB-2001) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G., Hammond L., Street J., Darke C.;
RT   "Confirmatory sequence and serology of HLA-DRB1*0816";
RL   Unpublished.
XX
DR   MD5; 4a12ab2acb634299c2d8a0a83312e62a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="24131"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*0816 allele"
FT                   /db_xref="GOA:Q9BD02"
FT                   /db_xref="IMGT/HLA:DRB1*08:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD02"
FT                   /protein_id="CAC33572.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEDVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 63 C; 99 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer