Dbfetch

ID   AJ309573; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   AJ309573;
XX
DT   15-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*40013 allele, exons
DE   2-4
XX
KW   HLA-B gene; HLA-B*40013 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Dormoy A.;
RT   ;
RL   Submitted (13-FEB-2001) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Theodorou I., Weschler B., Tongio M.M.;
RT   "A silent mutation has been found in a B*4001 allele";
RL   Unpublished.
XX
DR   MD5; 3cdc48ac0eb50252a6bc6524d499933e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,271..546,547..>822)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*40:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD03"
FT                   /protein_id="CAC29240.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /number=2
FT   intron          270^271
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /number=3
FT   intron          546^547
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /number=3
FT   exon            547..822
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40013"
FT                   /number=4
XX
SQ   Sequence 822 BP; 180 A; 255 C; 272 G; 115 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctgaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggt ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg       780
     tacagcatga ggggctgccg aagcccctca ccctgagatg gg                          822
//