spacer

EBI Dbfetch

ID   AJ309194; SV 1; linear; genomic DNA; STD; HUM; 3447 BP.
XX
AC   AJ309194;
XX
DT   10-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele B*4201, exons 1-7
XX
KW   HLA-B gene; HLA-B*4201 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3447
RA   Cox S.T.;
RT   ;
RL   Submitted (09-APR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*4201";
RL   Unpublished.
XX
DR   MD5; 05a6859ba158cf29346683b731cc9462.
DR   EPD; EP73522; HS_HLA-B.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3447
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="confirmatory sequence of B*4201"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1019..1294,1867..2142,2236..2352,
FT                   2794..2826,2933..2976)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="B*4201 allele"
FT                   /db_xref="GOA:P30480"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*42:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30480"
FT                   /protein_id="CAC38393.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4201 allele"
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4201 allele"
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4201 allele"
FT   intron          773..1018
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4201 allele"
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4201 allele"
FT   intron          1295..1866
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4201 allele"
FT   exon            1867..2142
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4201 allele"
FT   intron          2143..2235
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4201 allele"
FT   exon            2236..2352
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4201 allele"
FT   intron          2353..2793
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4201 allele"
FT   exon            2794..2826
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4201 allele"
FT   intron          2827..2932
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4201 allele"
FT   exon            2933..>2976
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*4201 allele"
XX
SQ   Sequence 3447 BP; 636 A; 1000 C; 1088 G; 723 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     ctgagtttca cttcttctcc caacttgtgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccactt cccactccca ttgggtattg gatatctaga gaagccaatc agcgtcgccg       240
     cggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga       300
     gatgctggtc atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcaccccc aggctcccac tccatgaggt atttctacac ctccgtgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       660
     caggaggggc cggagtattg ggaccggaac acacagatct acaaggccca ggcacagact       720
     gaccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac ggacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gctcgggggg acggggctga ccgcggggcc ggggccaggg      1020
     tctcacaccc tccagagcat gtacggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcataacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc      1140
     tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gtggcggagc aggacagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggacac gctggagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1560
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1620
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1680
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg catccgctgg      1740
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtg ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1860
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      2100
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      2160
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      2220
     cccctccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc attgttgctg      2280
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2340
     ggaagagctc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg tcccactggg      2400
     ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggatgcag catccacaca      2460
     ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc agcacatgtg      2520
     acaatgaagg acggatgtat caccttggtg gttgtggtgt tggggtcctg attccagcat      2580
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tggtccagga      2640
     cccacacttg ctttcctcgt gtttcctgat cctgccttgg gtctgtagtc atacttctgg      2700
     aaattccttt tgggtccaag acgaggaggt tcctctaaga tctcatggcc ctgcttcctc      2760
     ccagtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tactctcagg      2820
     ctgcgtgtaa gtgatggggg tgggagtgtg gaggagctca cccaccccat aattcctcct      2880
     gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc aggcagcgac      2940
     agtgcccagg gctctgatgt gtctctcaca gcttgaaaag gtgagattct tggggtctag      3000
     agtgggtggg gtggcgggtc tgggggtggg tggggcagtg gggaaaggcc tgggtaatgg      3060
     agattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagagtgt catcacttac      3120
     catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac agctgtcttg      3180
     tgagggactg agatgcagga tttcttcacg cctccccttt gtgacttcaa gagcctctgg      3240
     catctctttc tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata atgtgaggag      3300
     gtggagagac agcccaccct tgtgtccact gtgacccctg ttcgcatgct gacctgtgtt      3360
     tcctccccag aagcttgcgg aagggcgaat tccagcacac tggcggccgt tactagtgga      3420
     tccgagctcg gtaccaagct tgatgca                                          3447
//


spacer
spacer