spacer

EBI Dbfetch

ID   AJ309193; SV 2; linear; genomic DNA; STD; HUM; 3337 BP.
XX
AC   AJ309193;
XX
DT   10-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*4101, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*4101 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (09-APR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*4101";
RL   Unpublished.
XX
RN   [3]
RP   1-3337
RA   Cox S.T.;
RT   ;
RL   Submitted (15-NOV-2004) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 4c00bc5fa689cf2e64ca7418b9f4f809.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3337
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(192..264,393..662,909..1184,1757..2032,2126..2242,
FT                   2684..2716,2823..2866)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:P30479"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*41:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3LN4"
FT                   /db_xref="PDB:3LN5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30479"
FT                   /protein_id="CAC38392.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <192..264
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=1
FT   intron          265..392
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=1
FT   exon            393..662
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=2
FT   intron          663..908
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=2
FT   exon            909..1184
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=3
FT   intron          1185..1756
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=3
FT   exon            1757..2032
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=4
FT   intron          2033..2125
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=4
FT   exon            2126..2242
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=5
FT   intron          2243..2683
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=5
FT   exon            2684..2716
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=6
FT   intron          2717..2822
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=6
FT   exon            2823..>2866
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4101"
FT                   /number=7
XX
SQ   Sequence 3337 BP; 618 A; 971 C; 1045 G; 703 T; 0 other;
     ccccactccc acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata        60
     ctcgtgacgc gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc       120
     agcgtcgccg tggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct       180
     cagacgccga gatgcgggtc acggcacccc gaaccgtcct cctgctgctc tcggcggccc       240
     tggccctgac cgagacctgg gccggtgagt gcgggtcggc agggaaatgg cctctgtggg       300
     gaggagcgag gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg       360
     tcgggcgggt ctcagctcct cctcgccccc aggctcccac tccatgaggt atttccacac       420
     cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga       480
     cacgctgttc gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc       540
     atggatagag caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa       600
     cacacagact taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc       660
     cggtgagtga ccccggcccg gggcgcaggt cacgactccc catcccccac ggacggcccg       720
     ggtcgccccg agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga       780
     ccctcgaccg gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa       840
     atccccgcgg gttggtcggg gcggggcggg gctcgggggg acggggctga ccgcggggcc       900
     tgggccaggg tctcacactt ggcagaggat gtatggctgc gacgtggggc cggacgggcg       960
     cctcctccgc gggcataacc agtacgccta cgacggcaag gattacatcg ccctgaacga      1020
     ggacctgcgc tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga      1080
     ggcggcccgt gtggcggagc aggacagagc ctacctggag ggcacgtgcg tggagtggct      1140
     ccgcagatac ctggagaacg ggaaggacac gctggagcgc gcgggtacca ggggcagtgg      1200
     ggagccttcc ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa      1260
     atgggatcag cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga      1320
     gtttcctctg agggccccct cttctctcta gacaattaag ggatgacgtc tctgaggaaa      1380
     tggaggggaa gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc      1440
     cttgggaacc gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg      1500
     gggctctgat tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc      1560
     cctgttcccc gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg      1620
     catccgctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca      1680
     ggctggtcac atgggtggtc ctagggtgtg ccatgagaga tgcaaagcgc ctgaattttc      1740
     tgactcttcc catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat      1800
     gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg      1860
     cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga      1920
     gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac      1980
     acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag      2040
     ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc      2100
     ccctcatctt cccctccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc      2160
     attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg      2220
     atgtgtagga ggaagagctc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg      2280
     tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggatgcag      2340
     catccacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc      2400
     agcacatgtg acaatgaagg acggatgtat caccttggtg gttgtggtgt tggggtcctg      2460
     attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt      2520
     tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccttgg gtctgtagtc      2580
     atacttctgg aaattccttt tgggtccaag acgaggaggt tcctctaaga tctcatggcc      2640
     ctgcttcctc ccagtcccct cacagggcat tttcttccca caggtggaaa aggagggagc      2700
     tactctcagg ctgcgtgtaa gtgatggggg tgggagtgtg gaggagctca cccaccccat      2760
     aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc      2820
     aggcagcgac agtgcccagg gctctgatgt gtctctcaca gcttgaaaag gtgagattct      2880
     tggggtctag agtgggtggg gtggcgggtc tgggggtggg tggggcagtg gggaaaggcc      2940
     tgggtaatgg agattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagagtgt      3000
     catcacttac catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac      3060
     agctgtcttg tgagggactg agatgcagga tttcttcacg cctccccttt gtgacttcaa      3120
     gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata      3180
     atgtgaggag gtggagagac agcccaccct tgtgtccact gtgacccctg ggcgcatgct      3240
     gacctgtgtt tcctccccag aagcttgcgg aagggcgaat tccagcacac tggcggccgt      3300
     tactagtgga tccgagctcg gtaccaagct tgatgca                               3337
//


spacer
spacer