spacer

EBI Dbfetch

ID   AJ309139; SV 1; linear; genomic DNA; STD; HUM; 3190 BP.
XX
AC   AJ309139;
XX
DT   05-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*4801 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*4801 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3190
RA   Cox S.T.;
RT   ;
RL   Submitted (04-APR-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of B*4801";
RL   Unpublished.
XX
DR   MD5; d18c3e44abbffa29451fd11ae1b17b33.
DR   EPD; EP73522; HS_HLA-B.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3190
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1018..1293,1868..2143,2237..2353,
FT                   2795..2827,2934..2977)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="B*4801 allele"
FT                   /db_xref="GOA:P30486"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*48:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30486"
FT                   /protein_id="CAC38066.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4801 allele"
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4801 allele"
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4801 allele"
FT   intron          773..1017
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4801 allele"
FT   exon            1018..1293
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4801 allele"
FT   intron          1294..1867
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4801 allele"
FT   exon            1868..2143
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4801 allele"
FT   intron          2144..2236
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4801 allele"
FT   exon            2237..2353
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4801 allele"
FT   intron          2354..2794
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4801 allele"
FT   exon            2795..2827
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4801 allele"
FT   intron          2828..2933
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4801 allele"
FT   exon            2934..>2977
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*4801 allele"
XX
SQ   Sequence 3190 BP; 590 A; 920 C; 1015 G; 665 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     ctgagtttca cttcttctcc caacttgtgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccactt cccactccca ttgggtattg gatatctaga gaagccaatc agcgtcgccg       240
     cggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccga       300
     gatgctggtc atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       480
     ctcagcccct cctcaccccc aggctcccac tccatgaggt atttctacac ctccgtgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacccagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       660
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       720
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttggtcggg gcggggcggg gctcggggga ctgggctgac cgcggggccg gggccagggt      1020
     ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg      1080
     ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct      1140
     cctggaccgc cgcggacacg gcggctcaga tctcccagcg caagttggag gcggcccgtg      1200
     tggcggagca gctgagagcc tacctggagg gcgagtgcgt ggagtggctc cgcagatacc      1260
     tggagaacgg gaaggacaag ctggagcgcg ctggtaccag gggcagtggg gagccttccc      1320
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1380
     gctagaatgt cgccctccgt tgaatggaga atggcatgag ttttcctgag tttcctctga      1440
     gggccccctc ttctctctag acaattaagg aatgacgtct ctgaggaaat ggaggggaag      1500
     acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1560
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1620
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1680
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1740
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1800
     catgggtggt cctagggtgt cccatgaaag atgcaaagcg cctgaatttt ctgactcttc      1860
     ccatcagacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1920
     ctgaggtgct gggccctggg tttctaccct gcggagatca cactgacctg gcagcgggat      1980
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      2040
     ttccagaagt ggacagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      2100
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      2160
     gggtcatatc tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct      2220
     tcccctcctt tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      2280
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2340
     aggaagagtt caggtaggga aggggtgagg ggtggggtct gggttttctt gtcccactgg      2400
     gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatgcacac      2460
     aggggctaac gcagcctggg accctgtgtg ccagcactta ctcttttgtg cagcacatgt      2520
     gacaatgaag gatggatgta tcaccttgat ggttgtggtg ttggggtcct gattccagca      2580
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg      2640
     acccacactt gctttcctcg tgtttcctga tcctgccctg ggtctgtagt catacttctg      2700
     gaaattcctt ttgggtccaa gactaggagg ttcctctaag atctcatggc cctgcttcct      2760
     cccagtgccc tcacaggaca ttttcttccc acaggtggaa aaggagggag ctactctcag      2820
     gctgcgtgta agtggtgggg gtgggagtgt ggaggagctc acccacccca taattcctcc      2880
     tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga      2940
     cagtgcccag ggctctgatg tgtctctcac agcttgaaaa ggtgagattc ttggggtcta      3000
     gagtgggtgg ggtggcgggt ctgggggtgg gtggggcaga ggggaaaggc ctgggtaatg      3060
     gggattcttt gattgggatg tttcgcgtgt gtggtgggct gtttagagtg tcatcgctta      3120
     ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt      3180
     gtgagggact                                                             3190
//


spacer
spacer