Dbfetch

ID   AJ308991; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ308991;
XX
DT   23-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, B*38021 allele,
DE   exon 2 and joined CDS
XX
KW   HLA-B gene; HLA-B*38021 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (20-MAR-2001) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Street J., Guttridge M.G., Thompson J., Darke C.;
RT   "Genetics, serology and sequences of dix low frequency HLA-ClassI alleles";
RL   Eur. J. Immunogenet. 28:502-502(2001).
XX
DR   MD5; 2edc38d4424bfd02acad066c13c94cf2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="32764"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ308992.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /gene_synonym="HLA-B*38021"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*38021 allele"
FT                   /db_xref="GOA:Q95365"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*38:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95365"
FT                   /protein_id="CAC34965.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRTALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*38021 allele"
XX
SQ   Sequence 270 BP; 60 A; 88 C; 85 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//