spacer

EBI Dbfetch

ID   AJ308547; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AJ308547;
XX
DT   26-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, B*new allele,
DE   exons 2-3
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Vidal S.;
RT   ;
RL   Submitted (22-FEB-2001) to the INSDC.
RL   Vidal S., Immunology, Hospital Sant Pau, Pare Claret, 167, Barcelona 08025,
RL   SPAIN.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.580510.x.
RX   PUBMED; 11844147.
RA   Vidal S., Morante M.P., Mosquera A.M., Moga E., Querol S., Garcia J.,
RA   Rodriguez-Sanchez J.L.;
RT   "Identification and sequencing of the HLA-B*4106 allele";
RL   Tissue Antigens 58(5):343-344(2001).
XX
DR   MD5; 021dc98d0945aade79d983bd92a70838.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-B"
FT                   /note="B*new allele"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*new allele"
FT                   /db_xref="GOA:Q9BD05"
FT                   /db_xref="IMGT/HLA:B*41:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD05"
FT                   /protein_id="CAC32990.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*new allele"
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*new allele"
FT   exon            517..>792
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*new allele"
XX
SQ   Sequence 792 BP; 144 A; 262 C; 284 G; 102 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgg acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggcctg ggccagggtc tcacacttgg cagaggatgt       540
     atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer