Dbfetch

ID   AJ308423; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ308423;
XX
DT   02-FEB-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, A*30new allele,
DE   isolate 19302, exon 2 and joined CDS
XX
KW   HLA-A gene; human leucocyte antigen A; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (02-FEB-2001) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New HLA-A alleles detected by sequence based typing";
RL   Unpublished.
XX
DR   MD5; bd89bd11174db89f5debcbd863e3e6f5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="19302"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ308424.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="A*30new allele"
FT                   /db_xref="GOA:Q8WLQ6"
FT                   /db_xref="IMGT/HLA:A*30:11:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLQ6"
FT                   /protein_id="CAC88116.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARWAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*30new allele"
XX
SQ   Sequence 270 BP; 55 A; 81 C; 96 G; 38 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//