spacer

EBI Dbfetch

ID   AJ306733; SV 1; linear; genomic DNA; STD; HUM; 3399 BP.
XX
AC   AJ306733;
XX
DT   21-APR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, A*1105 allele, exons 1-8
XX
KW   HLA-A gene; HLA-A*1105 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3399
RA   Dunn P.P.;
RT   ;
RL   Submitted (19-APR-2001) to the INSDC.
RL   Dunn P.P., H & I DNA Reference Laboratory, National Blood Service,
RL   Southmead Road, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.1999.530612.x.
RX   PUBMED; 10395112.
RA   Morrell G., Whalley J., Stewart A., Day S., Lewis L., Makar Y., Ross J.,
RA   Dunn P.P.;
RT   "Identification of an HLA-A11 serological variant and its characterization
RT   by sequencing based typing";
RL   Tissue Antigens 53(6):591-594(1999).
XX
DR   MD5; 53bf667b66c25181b4a55715092f8cf1.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3399
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<326..398,529..798,1040..1315,1895..2170,2273..2389,
FT                   2832..2864,3007..3054,3225..>3229)
FT                   /gene="HLA-A"
FT                   /note="A*1105 allele"
FT   CDS             join(326..398,529..798,1040..1315,1895..2170,2273..2389,
FT                   2832..2864,3007..3054,3225..3229)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="A*1105 allele"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4BEO"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="CAC37336.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITERKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   sig_peptide     326..398
FT                   /gene="HLA-A"
FT                   /note="A*1105 allele"
FT   exon            326..398
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*1105 allele"
FT   intron          399..528
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*1105 allele"
FT   mat_peptide     join(529..798,1040..1315,1895..2170,2273..2389,2832..2864,
FT                   3007..3054,3225..3226)
FT                   /gene="HLA-A"
FT                   /product="HLA-A11variant"
FT                   /note="A*1105 allele"
FT   exon            529..798
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*1105 allele"
FT   intron          799..1039
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*1105 allele"
FT   exon            1040..1315
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*1105 allele"
FT   intron          1316..1894
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*1105 allele"
FT   exon            1895..2170
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*1105 allele"
FT   intron          2171..2272
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*1105 allele"
FT   exon            2273..2389
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*1105 allele"
FT   intron          2390..2831
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*1105 allele"
FT   exon            2832..2864
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*1105 allele"
FT   intron          2865..3006
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*1105 allele"
FT   exon            3007..3054
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="A*1105 allele"
FT   intron          3055..3224
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="A*1105 allele"
FT   exon            3225..3229
FT                   /gene="HLA-A"
FT                   /number=8
FT                   /note="A*1105 allele"
XX
SQ   Sequence 3399 BP; 652 A; 983 C; 1048 G; 715 T; 1 other;
     agacattgag acagagcgct tcgcacaaga gcagaggggt cagggcgaag tcccagggcc        60
     ccaggcgtgg ctctcagggt ctcaggcccc gaaggcggtg tatggattgg ggagtcccag       120
     ccttggggat tccccaactc cgcagtttct tttctccctc tcccaaccta cgtagggtcc       180
     ttcatcctgg atactcacga cgcggaccca gttctcactc ccattgggtg tcgggtttcc       240
     agagaagcca atcagtgtct tcgcggtcgc tcttctaaag tccgcacgca cccaccggga       300
     ctcagattct ccccagaccc cgaggatggc cgtcatggcg ccccgaaccc tcctcctgct       360
     actctcgggg gccctggccc tgacccagac ctgggcgggt gagtgcgggg tcgggaggga       420
     aaccgcctct gcggggagaa gcaaggggcc ctcctggcgg gggcgcagga ccgggggagc       480
     cgcgccggga ggagggtcgg gcaggtctca gccactgctc gcccccaggc tcccactcca       540
     tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc ttcatcgccg       600
     tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agccagagga       660
     tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac caggagacac       720
     ggaatgtgaa ggcccagtca cagactgacc gagtggacct ggggaccctg cgcggctact       780
     acaaccagag cgaggacggt gagtgacccc ggcccggggc gcaggtcacg acccctcatc       840
     ccccacggac gggccaggtg gcccacagtc tccgggtccg agatccaccc cgaagccgcg       900
     ggaccccgag acccttgccc cgggagaggc ccaggcgcct ttacccggtt tcattttcag       960
     tttaggccaa aaatcccccc gggttggtcg gggccgggca gggcttgggg gactgggctg      1020
     accgcggggt cggggccagg ttctcacacc atccagataa tgtatggctg cgacgtgggg      1080
     ccggacgggc gcttcctccg cgggtaccgg caggacgcct acgacggcaa ggattacatc      1140
     gccctgaacg aggacctgcg ctcttggacc gcggcggaca tggcagctca gatcaccgag      1200
     cgcaagtggg aggcggccca tgcggcggag cagcagagag cctacctgga gggccggtgc      1260
     gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg cacgggtacc      1320
     aggggccacg gggcgcctcc ctgatcgcct atagatctcc cgggctggcc tcccacaagg      1380
     aggggagaca attgggacca acactagaat atcaccctcc ctctggtcct gagggagagg      1440
     aatcctcctg ggtttccaga tcctgtacca gagagtgact ctgaggttcc gccctgctct      1500
     ctgacacaat taagggataa aatctctgaa ggagtgacgg gaagacgatc cctcgaatac      1560
     tgatgagtgg ttccctttga caccggcagc agccttgggc ccgtgacttt tcctctcagg      1620
     ccttgttctc tgcttcacac tcaatgtgtg tgggggtctg agtccagcac ttctgagtct      1680
     ctcagcctcc actcaggtca ggaccagaag tcgctgttcc cttctcaggg aatagaagat      1740
     tatcccaggt gcctgtgtcc aggctggtgt ctgggttctg tgctctcttc cccatcccgg      1800
     gtgtcctgtc cattctcaag atggccacat gcgtgctggt ggagtgtccc atgacagatg      1860
     caaaatgcct gaattttctg actcttcccg tcagaccccc ccaagacaca tatgacccac      1920
     caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg      1980
     gagatcacac tgacctggca gcgggatggg gaggaccaga cccaggacac ggagctngtg      2040
     gagaccaggc ctgcagggga tggaaccttc cagaagtggg cggctgtggt ggtgccttct      2100
     ggagaggagc agagatacac ctgccatgtg cagcatgagg gtctgcccaa gcccctcacc      2160
     ctgagatggg gtaaggaggg agatgggggt gtcatgtctc ttagggaaag caggagcctc      2220
     tctggagacc tttagcaggg tcagggcccc tcaccttccc ctcttttccc agagctgtct      2280
     tcccagccca ccatccccat cgtgggcatc attgctggcc tggttctcct tggagctgtg      2340
     atcactggag ctgtggtcgc tgccgtgatg tggaggagga agagctcagg tggagaaggg      2400
     gtgaaaggtg gggtctgaga tttcttgtct cactgagggt tccaagcccc agctagaaat      2460
     gtgccctgtc tcattactgg gaagcacctt ccacaatcat gggccgaccc agcctgggcc      2520
     ctgtgtgcca gcacttactc ttttgtaaag cacctgttac aatgaaggac agatttatca      2580
     ccttgattac ggcggtgatg ggacctgatc ccagcagtca caagtcacag gggaaggtcc      2640
     ctgacgacag acctcaggag ggcgattggt ccagggccca catctgcttt cttcatgttt      2700
     cctgatcccg ccctgggtct gcagtcacac atttctggaa acttctctgg ggtccaagac      2760
     taggaggttc ctctaggacc ttaaggccct ggctcctttc tggtatctca caggacattt      2820
     tcttcccaca gatagaaaag gagggagtta ctctcaggct gcaagtaagt atgaaggagg      2880
     ctgatgcctg aggtccttgg gatattgtgt ttgggagccc atgggggagc tcacccaccc      2940
     cacaattcct cctctagcca catcttctgt gggatctgac caggttctgt ttttgttcta      3000
     ccccaggcag tgacagtgcc cagggctctg atgtgtctct cacagcttgt aaaggtgaga      3060
     gcttggaggg cctgatgtgt gttgggtgtt gggcggaaca gtggacacag ctgtgctatg      3120
     gggtttcttt gcattggatg tattgagcat gcgatgggct gtttaaagtg tgacccctca      3180
     ctgtgacaga tatgaatttg ttcatgaata ttttttttct atagtgtgag acagctgcct      3240
     tgtgtgggac tgagaggcaa gagttgttcc tgcccttccc tttgtgactt gaagaaccct      3300
     gactttgttt ctgcaaaggc acctgcatgt gtctgtgttc gtgtaggcat aatgtgagga      3360
     ggtggggaga ccaccccacc cccatgtcca ccatgaccc                             3399
//


spacer
spacer