Dbfetch

ID   AJ306634; SV 1; linear; genomic DNA; STD; HUM; 3065 BP.
XX
AC   AJ306634;
XX
DT   10-APR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, A*23N allele, exons 1-7
XX
KW   HLA-A gene; HLA-A*23N allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3065
RA   Dormoy A.;
RT   ;
RL   Submitted (05-APR-2001) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Perrier P., Tongio M.M.;
RT   "A new HLA-A*null allele : A*23 null allele";
RL   Unpublished.
XX
DR   MD5; bf236859b9d2b6283a849fa619741ccb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3065
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<217..289,420..689,931..1206,1786..2062,2165..2281,
FT                   2724..2756,2899..2946)
FT                   /gene="HLA-A"
FT                   /note="A*23N allele"
FT   CDS             join(217..289,420..689,931..1206,1786..1826)
FT                   /gene="HLA-A"
FT                   /product="HLA-A protein"
FT                   /function="MHC class I antigen"
FT                   /note="A*23N allele"
FT                   /note="insertion at the 5' end of the exon 4 leads to a
FT                   premature stop codon at amino acid position 196"
FT                   /db_xref="IMGT/HLA:A*23:07N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCN1"
FT                   /protein_id="CAC36395.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVDGLRRYLENGKETLQRTDPPQDTYDPPPHL"
FT   exon            <217..289
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*23N allele"
FT   sig_peptide     217..288
FT                   /gene="HLA-A"
FT                   /note="A*23N allele"
FT   intron          290..419
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="A*23N allele"
FT   exon            420..689
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*23N allele"
FT   intron          690..930
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*23N allele"
FT   exon            931..1206
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*23N allele"
FT   intron          1207..1785
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*23N allele"
FT   exon            1786..2062
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*23N allele"
FT   intron          2063..2164
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="A*23N allele"
FT   exon            2165..2281
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*23N allele"
FT   intron          2282..2723
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="A*23N allele"
FT   exon            2724..2756
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*23N allele"
FT   intron          2757..2898
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="A*23N allele"
FT   exon            2899..2946
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="A*23N allele"
XX
SQ   Sequence 3065 BP; 586 A; 897 C; 947 G; 634 T; 1 other;
     gggagtccca gccttgggga ttccccaact ccgcagtttc ttttctccct ctcccaacct        60
     atgtagggtc cttcttcctg gatactcacg acgcggaccc agttctcact cccattgggt       120
     gtcgggtttc cagagaagcc aatcagtgtc gtcgcggtcg ctgttctaaa gtccgcacgc       180
     acccaccggg actcagattc tccccagacg ccgaggatgg ccgtcatggc gccccgaacc       240
     ctcgtcctgc tactctcggg ggccctggcc ctgacccaga cctgggcagg tgagtgcggg       300
     gtcgggaggg aaacggcctc tgcggggaga agcaaggggc ccgcctggcg ggggcgcaag       360
     acccgggaag ccgcgccggg aggagggtcg ggcgggtctc agccactcct cgtccccagg       420
     ctcccactcc atgaggtatt tctccacatc cgtgtcccgg cccggccgcg gggagccccg       480
     cttcatcgcc gtgggctacg tggacgacac gcagttcgtg cggttcgaca gcgacgccgc       540
     gagccagagg atggagccgc gggcgccgtg gatagagcag gaggggccgg agtattggga       600
     cgaggagaca gggaaagtga aggcccactc acagactgac cgagagaacc tgcggatcgc       660
     gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac       720
     gacccctcat cccccacgga cgggccgggt cgcccacagt ctccgggtcc gagatccacc       780
     ccgaagccgc gggaccccga gacccttgcc ccgggagagg cccaggcgcc ttaacccggt       840
     ttcattttca gtttaggcca aaaatccccc cgggttggtc ggggccgggc ggggctcggg       900
     ggactgggct gaccgcgggg tcggggccag gttctcacac cctccagatg atgtttggct       960
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca      1020
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcggctc      1080
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg      1140
     agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc      1200
     gcacgggtac caggggccac ggggcgccta cctgatcgcc tgtaggtctc ccgggctggc      1260
     ctcccacaag gaggggagac aattgggacc aacactagaa tatcgccctc cctctggtcc      1320
     tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgac tctgaggttc      1380
     cgccctgctc tctgacacaa ttaagggata aaatctctga cggaatgacg gaaagacgat      1440
     ccctcgaata ctgatgactg gttccctttg acaccggcag cagccttggg accgtgactt      1500
     ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct gagtccagca      1560
     cttctgagtc cctcagcctc cactcaggtc aggaccagaa gtcgctgttc cctcctcagg      1620
     gaatagaaga ttatcccagg tgcctgtgtc caggctggtg tctgggttct gtgctctctt      1680
     ccccatcccg ggtgtcctgt ccattctcaa gatggccaca tgcatgctgg tggagtgtcc      1740
     catgacagat gcaaaatgcc tgaattttct gactcttccs gtcagacccc ccccaagaca      1800
     catatgaccc accaccccat ctctgaccat gaggccactc tgagatgctg ggccctgggc      1860
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1920
     acggagcttg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcagctgtg      1980
     gtggtacctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      2040
     aagcccctca ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa      2100
     agcaggagcc tctctggaga cctttagcag ggtcagggcc cctcaccttc ccctcttttc      2160
     ccagagccat cttcccagcc caccgtccac atcgtgggca tcattgctgg cctggttctc      2220
     cttggagctg tgatcactgg agctgtggtc gctgctgtga tgtggaggag gaacagctca      2280
     ggtggagaag gggtgaaggg tggggtctga gatttcttgt ctcactgagg gttccaagcc      2340
     ccagctagaa atgtgccctg tctcattact gggaagcacc atccacaatc atgggccgac      2400
     ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa agcacctgtg acaatgaagg      2460
     acagatttat caccttgatt atggcggtga tgggacctga tcccagcagt cacaagtcac      2520
     aggggaaggt ccctgacgac agatctcagg agggcgattg gtccagggcc cacatctgct      2580
     ttcttcatgt ttcctgatcc tgccctgggt ctgcagtcac acatttctgg aaacttctct      2640
     ggggtccaag actaggaggt tcctctagga ccttaaggcc ctggctcctt tctggtatct      2700
     cacaggacat tttcttccca cagatagaaa aggagggagc tactctcagg ctgcaagtaa      2760
     gtatgaagga ggctgatgcc tgaggtcctt gggatattgt gtttgggagc ccatggggga      2820
     gctcaaccac cccacaattc ctcctctagc cacatcttct gtgggatctg accaggttct      2880
     gtttttgttc taccccaggc agtgacagtg cccagggctc tgatgtgtct ctcacagctt      2940
     gtaaaggtga gagcttggag ggcctgatgt gtgttgggtg ttgggcggaa cagtggacac      3000
     agctgtgcta tggggtttct ttgcattgga tgtattgagc atgcgatggg ctgtttaaag      3060
     tgtga                                                                  3065
//