spacer

EBI Dbfetch

ID   AJ304496; SV 2; linear; genomic DNA; STD; HUM; 3116 BP.
XX
AC   AJ304496;
XX
DT   16-DEC-2000 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, Cw*1208 allele, exons 1-8
XX
KW   HLA-C gene; HLA-Cw*1208 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [4]
RA   Cox S.T.;
RT   ;
RL   Submitted (13-DEC-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.2002.590110.x.
RX   PUBMED; 11972880.
RA   Cox S.T., Ogilvie H., Bohan E.M., Holman R., Prentice H.G., Potter M.,
RA   Madrigal J.A., Little A.-M.;
RT   "Sequence of two new HLA-Cw alleles: HLA-Cw*0313 and HLA-Cw*1208";
RL   Tissue Antigens 59(1):49-51(2002).
XX
RN   [4]
RP   1-3116
RA   Cox S.T.;
RT   ;
RL   Submitted (17-JUN-2003) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 42f53be03c89571942e18d04b013bec8.
DR   Ensembl-Gn; ENSG00000228299; homo_sapiens.
DR   Ensembl-Tr; ENST00000420206; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3116
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..>2895)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="Cw*1208 allele"
FT   CDS             join(1..73,204..473,720..995,1583..1858,1980..2099,
FT                   2539..2571,2679..2726,2891..2895)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="Cw*1208 allele"
FT                   /db_xref="GOA:P30508"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*12:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="CAC19018.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="Cw*1208 allele"
FT   intron          74..203
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="Cw*1208 allele"
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*1208 allele"
FT   intron          474..719
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*1208 allele"
FT   exon            720..995
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*1208 allele"
FT   intron          996..1582
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*1208 allele"
FT   exon            1583..1858
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="Cw*1208 allele"
FT   intron          1859..1979
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="Cw*1208 allele"
FT   exon            1980..2099
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="Cw*1208 allele"
FT   intron          2100..2538
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="Cw*1208 allele"
FT   exon            2539..2571
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="Cw*1208 allele"
FT   intron          2572..2678
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="Cw*1208 allele"
FT   exon            2679..2726
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="Cw*1208 allele"
FT   intron          2727..2890
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="Cw*1208 allele"
FT   exon            2891..>2895
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="Cw*1208 allele"
XX
SQ   Sequence 3116 BP; 585 A; 904 C; 983 G; 644 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaaacgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaac tacaagcgcc aggcacaggc       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggctggggcg gggctcgggg gacggggctg accacggggg cggggccagg       720
     gtctcacacc ctccagagga tgtacggctg cgacctgggg cccgacgggc gcctcctccg       780
     cgggtatgac cagtccgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       840
     ctcctggacc gctgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgaggcggag cagtggagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cccatctcct gtagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca      1080
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcacg ctcaatgtgt      1320
     ttaaaggttt gattccagct tttctgagtc cttcggcctc cactcaggtc aggaccagaa      1380
     gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta tcccaggtgc      1440
     ctgtgtccag gctggcgtct gggttctgtg cccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggat ggtcacatgg gcgctgttgg agtgtcgcaa gagagataca aagtgtctga      1560
     attttctgac tcttcccgtc agaacaccca aagacacacg tgacccacca tcccgtctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagc gggatggcga ggaccaaact caggacaccg agcttgtgga gaccaggcca      1740
     gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      1800
     agatacacgt gccatgtgca gcacgagggg ctgccagagc ccctcaccct gagatggggt      1860
     aaggaggggg atgaggggtc atgtgtcttc tcagggaaag cagaagtcct ggagcccttc      1920
     agccgggtca gggctgaggc ttgggggtca gggcccctca ccttcccctc ctttcccaga      1980
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc      2040
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      2100
     tagggaaggg gtgaggagtg gggtctgggt tttcttgtcc cactgggagt ttcaagcccc      2160
     aggtagaagt gtgccccacc tcgttactgg aagcaccatc cacacatggg ccatcccagc      2220
     ctgggaccct gtgtgctagc acttactctg ttgtgaagca catgacaatg aaggacagat      2280
     gtatcacctt gatgattatg gtgttggggt ccttgattcc agcattcatg agtcagggga      2340
     aggtccctgc taaggacaga ccttaggagg gcagttgctc cagaacccac agctgctttc      2400
     cccgtgtttc ctgatcctgc cctgggtctg cagtcatagt tctggaaact tctcttgggt      2460
     ccaagactag gaggttcccc taagatcgca tggccctgcc tcctccctgt cccctcacag      2520
     ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggctgcg tgtaagtgat      2580
     ggcggtgggc gtgtggagga gctcacccac cccataattc ctcttgtccc acatctcctg      2640
     cgggctctga ccaggtcttt ttttttgttc taccccagcc agcaacagtg cccagggctc      2700
     tgatgagtct ctcatcgctt gtaaaggtga gattctgggg agctgaagtg gtctggggtg      2760
     gggcagaggg aaaaggccta ggtaatgggg atcctttgat tgggacgttt cgaatgtgtg      2820
     gtgagctgtt cagagtgtca tcacttacca tgactgacct gaatttgttc atgactattg      2880
     tgttctgtag cctgagacag ctgcctgtgt gggactgaga tgcaggattt cttcacacct      2940
     ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct gaatgtgtct      3000
     gcgttcctgt tagcataatg tgaggaggtg gagagacagc ccacccccgt gtccaccgtg      3060
     acccctgtcc ccacactgac ctgtgttccc tccccgaaag cttgcggaag ggcgaa          3116
//


spacer
spacer