spacer

EBI Dbfetch

ID   AJ303359; SV 3; linear; genomic DNA; STD; HUM; 3504 BP.
XX
AC   AJ303359;
XX
DT   30-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens HLA-A gene for, A*2901 allele, exons 1-8
XX
KW   HLA-A gene; HLA-A*2901 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by [3]
RA   Blasczyk R.;
RT   ;
RL   Submitted (02-JAN-2001) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Elsner H.A., Bernard G., Bernard A., Blasczyk R.;
RT   "The non-expression of A*2901N is caused by a defect splicing site in
RT   intron 4";
RL   Unpublished.
XX
RN   [3]
RP   1-3504
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-AUG-2001) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
DR   MD5; 197c8eebe997c5e04c60052b5aa8a8db.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3504
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21"
FT                   /isolate="MHH-006933, AKB96676"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..523,653..922,1164..1439,2040..2315,2415..2531,
FT                   2973..3005,3148..3195,3365..>3504)
FT                   /gene="HLA-A"
FT   exon            <1..523
FT                   /gene="HLA-A"
FT                   /number=1
FT   CDS             join(451..523,653..922,1164..1439,2040..2315,2415..2531,
FT                   2973..3005,3148..3195,3365..3369)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6EXB0"
FT                   /db_xref="IMGT/HLA:A*29:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EXB0"
FT                   /protein_id="CAC27518.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCHVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   sig_peptide     451..523
FT                   /gene="HLA-A"
FT   intron          524..652
FT                   /gene="HLA-A"
FT                   /number=1
FT   mat_peptide     join(653..922,1164..1439,2040..2315,2415..2531,2973..3005,
FT                   3148..3195,3365..3369)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   exon            653..922
FT                   /gene="HLA-A"
FT                   /number=2
FT   intron          923..1163
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            1164..1439
FT                   /gene="HLA-A"
FT                   /number=3
FT   intron          1440..2039
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            2040..2315
FT                   /gene="HLA-A"
FT                   /number=4
FT   intron          2316..2414
FT                   /gene="HLA-A"
FT                   /number=4
FT   exon            2415..2531
FT                   /gene="HLA-A"
FT                   /number=5
FT   intron          2532..2971
FT                   /gene="HLA-A"
FT                   /number=5
FT   exon            2973..3005
FT                   /gene="HLA-A"
FT                   /number=6
FT   intron          3005..3146
FT                   /gene="HLA-A"
FT                   /number=6
FT   exon            3148..3195
FT                   /gene="HLA-A"
FT                   /number=7
FT   intron          3195..3363
FT                   /gene="HLA-A"
FT                   /number=7
FT   exon            3365..>3504
FT                   /gene="HLA-A"
FT                   /number=8
XX
SQ   Sequence 3504 BP; 672 A; 985 C; 1095 G; 752 T; 0 other;
     gtgggagtca gggagtccag ttcagggaca gagattacgg gatgaaaagt gaaaggagag        60
     ggacggggcc catgccgagg gtttctccct tgtttctcag acagctcttg ggccaagact       120
     cagggagaca ttgagacaga gagcttggca caggagcaga ggggtcaggg cgaagtccca       180
     gggccccagg cgtggctctc agggtctcag gccccgaagg cggtgtatgg attggggagt       240
     cccagccttg gggattcccc aactccgcag tttcttttct ccctctgcca acctatgtag       300
     ggtccttctt cctggatact cacgacgcgg acccagttct cactcccatt gggtgtcggg       360
     tttccagaga agccaatcag tgtcgtcgcg gtcgcggttc taaagtccgc acgcacccac       420
     cgggactcag attctcccca gacgccgagg atggccgtca tggcgccccg aaccctcctc       480
     ctgctactct tgggggccct ggccctgacc cagacctggg cgggtgagtg cggggtcgtg       540
     gggaaaccgc ctctgcgggg agaagcaagg ggcccgcccg gcggggacgc aggacccggg       600
     tagccgcgcc gggaggaggg tcgggtgggt ctcagccact cctcgccccc aggctcccac       660
     tccatgaggt atttcaccac atccgtgtcc cggcccggcc gcggggagcc ccgcttcatc       720
     gccgtgggct acgtggacga cacgcagttc gtgcggtttg acagcgacgc cgcgagccag       780
     aggatggagc cgcgggcacc gtggatagag caggaggggc cggagtattg ggacctgcag       840
     acacggaatg tgaaggccca gtcacagact gaccgagcga acctggggac cctgcgcggc       900
     tactacaacc agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgacctct       960
     catcccccac ggacgggccg ggtcgcccac agtctccggg tccgagatcc accccgaagc      1020
     cgcgggaccc cgagaccctt gccccgggag aggcccaggc gcctttaccc ggtttcattt      1080
     tcagtttagg ccaaaaatcc ccccgggttg gtcggggccg gacggggctc gggggactgg      1140
     gctgaccgtg gggtcggggc caggttctca caccatccag atgatgtatg gctgccacgt      1200
     ggggtcggac gggcgcttcc tccgcgggta ccggcaggac gcctacgacg gcaaggatta      1260
     catcgccttg aacgaggacc tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac      1320
     ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg agagcctacc tggagggcac      1380
     gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc agcgcacggg      1440
     taccgggggc cacggggcgc ctccctgatc gcctgtagat ctcccgggct ggcctcccac      1500
     aaggagggga gacaattggg accaacacta gaatatcgcc ctccctctgg tcctgaggga      1560
     gaggaatcct cctgggtttc cagatcctgt accagagagt gactctgagg ttccgccctg      1620
     ctctctgaca caattaaggg ataaaatctc tgaaggaatg acgggaagac gatccctcga      1680
     atactgatga gtggttccct ttgacacaca ccggcagcag ccttgggccc gtgacttttc      1740
     ctctcaggcc ttgttctctg cttcacactc aatgtgtgtg ggggtctgag tccagcactt      1800
     ctgagtccct cagcctccac tcaggtcagg accagaagtc gctgttccct cttcagggac      1860
     tagaattttc cacggaatag gagattatcc caggtgcctg tgtccaggct ggtgtctggg      1920
     ttctgtgctc ccttccccat cccaggtgtc ctgtccattc tcaagatagc cacatgtgtg      1980
     ctggaggagt gtcccatgac agatgcaaaa tgcctgaatg ttctgactct tcctgacaga      2040
     cgcccccaag acgcatatga ctcaccacgc tgtctctgac catgaggcca ccctgaggtg      2100
     ctgggccctg agcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga      2160
     ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa ccttccagaa      2220
     gtgggcgtct gtggtggtgc cttctggaca ggagcagaga tacacctgcc atgtgcagca      2280
     tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg ggggtgtcat      2340
     gtcttttagg gaaagcagga gcctctctga cctttagcag ggtcagggcc cctcaccttc      2400
     ccctcttttc ccagagccgt cttcccagcc caccatcccc atcgtgggca tcattgctgg      2460
     cctagttctc tttggagctg tgttcgctgg agctgtggtc gctgctgtga ggtggaggag      2520
     gaagagctca ggtggggtga agggatgaag ggtgggtctg agatttcttg tctcactgag      2580
     ggttccaaga cccaggtaga agtgtgccct gcctcgttac tgggaagcac catccacaat      2640
     tatgggccta cccagcctgg gccctgtgtg ccagcactta ctcttttgta aagcacctgt      2700
     taaaatgaag gacagattta tcaccttgat tacggcggtg atgggacctg atcccagcag      2760
     tcacaagtca caggggaagg tccctgagga ccttcaggag ggcggttggt ccaggaccca      2820
     cacctgcttt cttcatgttt cctgatcccg ccctgggtct gcagtcacac atttctggaa      2880
     acttctctga ggtccaagac ttggaggttc ctctaggacc ttaaggccct ggctcctttc      2940
     tggtatctca caggacattt tcttcccaca gaatagaaaa ggagggagct actctcaggc      3000
     tgcaagtaag tatgaaggag gctgatgcct gaggtccttg ggatattgtg tttgggagcc      3060
     cgtgggggag ctcacccacc ccacaattcc tcctctagcc acatcttctg tgggatctga      3120
     ccaggttctg tttttgtcct accccaggca gtgacagtgc ccagggctct gatatgtctc      3180
     tcacagcttg taaaggtgag agcctggagg gcctgatgtg tgttgggtgt tgggcggaac      3240
     agtggacgca gctgtgctat ggggtttctt tgcattggat gtattgagca tgcgatgggc      3300
     tgtttaaagt gtgactcctc actgtgacag atacgaattt gttcatgaat atttttttct      3360
     atagtgtgag acagctgcct tgtgtgggac tgagaggcaa gatttgttcc tgcccttccc      3420
     tttgtgactt gaagaaccct gactttgttt ctgcaaaggc acctgcatgt gtctgtgttc      3480
     ttgtaggcat aatgtgagga ggtg                                             3504
//


spacer
spacer