Dbfetch

ID   AJ301657; SV 1; linear; genomic DNA; STD; HUM; 3437 BP.
XX
AC   AJ301657;
XX
DT   06-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*1402 allele, exons 1-7
XX
KW   HLA-B gene; HLA-B*1402 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (24-NOV-2000) to the INSDC.
RL   Cox S.T., Dept of HLA sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*1402";
RL   Unpublished.
XX
RN   [3]
RP   1-3437
RA   Cox S.T.;
RT   ;
RL   Submitted (08-OCT-2004) to the INSDC.
RL   Cox S.T., Dept of HLA sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; ce9afd2d61097e8bf1b53755cde85d20.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3437
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,503..772,1019..1294,1867..2142,2236..2352,
FT                   2794..2826,2933..2976)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*1402 allele"
FT                   /db_xref="GOA:P30462"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30462"
FT                   /protein_id="CAC20461.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*1402 allele"
FT   intron          375..502
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            503..772
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*1402 allele"
FT   intron          773..1018
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*1402 allele"
FT   intron          1295..1866
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1867..2142
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*1402 allele"
FT   intron          2143..2235
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2236..2352
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*1402 allele"
FT   intron          2353..2793
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            2794..2826
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*1402 allele"
FT   intron          2827..2932
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            2933..2977
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*1402 allele"
XX
SQ   Sequence 3437 BP; 646 A; 991 C; 1080 G; 720 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     ctgagtttca cttcttctcc caacttgtgt cgggtccttc ttccaggata ctcgtgacgc       180
     atccccactt cccactccca ttgggtgtcg gatatctaga gaagccaatc agcgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agagtctcct cagacgccaa       300
     gatgctggtc atggcgcccc gaaccgtcct cctgctgctc tcggcggccc tggccctgac       360
     cgagacctgg gccggtgagt gcgggtcggg agggaaatgg cctctgccgg gaggagcgag       420
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       480
     ttcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccgtgtcc       540
     cggcccggcc gcggggagcc ccgcttcatc tcagtgggct acgtggacga cacgcagttc       600
     gtgaggttcg acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag       660
     caggaggggc cggaatattg ggaccggaac acacagatct gcaagaccaa cacacagact       720
     gaccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       780
     ccccggcccg gggcgcaggt cacgactccc catcccccac ggacggcccg ggtcgccccg       840
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       900
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       960
     gttgggcggg gcggggcggg gctcgggggg actgggctga ccgcgggggc ggggccaggg      1020
     tctcacaccc tccagtggat gtatggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggtataacc agttcgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt      1200
     gaggcggagc agctgagagc ctacctggag ggcacgtgcg tggagtggct ccgcagacac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaagaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     catgactttt cttctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ctctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata gattatccca ggtgcctgcg tccaggctgg      1740
     tgtctgggtt ctgtgtccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1860
     catcagaccc cccaaagaca catgtgaccc accaccccat ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gcgaggacca aactcaggac accgagcttg tggagaccag accagcagga gacagaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      2100
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      2160
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      2220
     cccctccttt cccagagcca tcttcccagt ccaccgtccc catcgtgggc attgttgctg      2280
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2340
     ggaagagttc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg tcccactggg      2400
     ggtttcaagc cccaggtaga agtgttccct gcatcattac tgggaagcag catgcacaca      2460
     ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc agcacatgtg      2520
     acaatgaagg acggatgtat caccttgatg gttgtggtgt tggggtcctg attccagcat      2580
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tggtccagga      2640
     cccacacttg ctttcctcgt gtttcctgat cctgccctgg gtctgtagtc atacttctgg      2700
     aaattccttt tgggtccaag actaggaggt tcctctaaga tctcatggcc ctgcttcctc      2760
     ccagtcccct cacaggacat tttgttccca caggtggaaa aggagggagc tactctcagg      2820
     ctgcgtgtaa gtggtggggg tgggagtgtg gaggagctca cccaccccat aattcctcct      2880
     gtcccacgtc tcctgtgggc tctgaccagg tcctgttttt gttctactcc agccagcgac      2940
     agtgcccagg gctctgatgt gtctctcaca gcttgaaaag gtgagattct tggggtctag      3000
     agtgggcggg ggggcgggga gggggcagag gggaaaggcc tgggtaatgg agattctttg      3060
     attgggatgt ttcgcgtgtg tgatgggctg ttcagagtgt catcacttac catgactaac      3120
     cagaatttgt tcatgactgt tgttttctgt agcctgagac agctgtcttg tgagggactg      3180
     agatgcagga tttcttcacg cctccccttt gtgacttcaa gagcctctgg catctctttc      3240
     tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata atgtgaggag gtggagagac      3300
     agcccaccct tgtgtccact gtgacccctg ttcgcatgct gacctgtgtt tcctccccag      3360
     aagcttgcgg aagggcgaat tccagcacac tggcggccgt tactagtgga tccgagctcg      3420
     gtaccaagct tgatgca                                                     3437
//