spacer

EBI Dbfetch

ID   AJ300766; SV 1; linear; genomic DNA; STD; HUM; 288 BP.
XX
AC   AJ300766;
XX
DT   18-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele Cw*01 exon
DE   3
XX
KW   HLA-C gene; HLA-Cw*01 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-288
RA   Bengtsson M.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   Bengtsson M., Dept of Oncology, Radiology and Clinical Immunology, Section
RL   of Clinical Immunology, Rudbeck Laboratory, University Hospital, SE-751 85
RL   Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new HLA C*01 variant";
RL   Unpublished.
XX
DR   MD5; bfd5c54d6e8e53b90592168c546ffdd9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..288
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <2..277
FT                   /gene="HLA-C"
FT                   /note="Cw*01"
FT   CDS             <2..>277
FT                   /codon_start=3
FT                   /gene="HLA C*"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="Cw*01"
FT                   /db_xref="GOA:Q9BD08"
FT                   /db_xref="IMGT/HLA:C*01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD08"
FT                   /protein_id="CAC24484.1"
FT                   /translation="SHTLQRMSGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            <2..277
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*01"
XX
SQ   Sequence 288 BP; 54 A; 92 C; 107 G; 35 T; 0 other;
     gggtctcaca ccctccagag gatgtctggc tgcgacctgg ggcccgacgg gcgcctcctc        60
     cgcgggtatg accagtacgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg       120
     cgctcctgga ccgccgcgga caccgcggct cagatcaccc agcgcaagtg ggaggcggcc       180
     cgtgaggcgg agcagcggag agcctacctg gagggcacgt gcgtggagtg gctccgcaga       240
     tacctggaga acgggaagga gacgctgcag cgcgcgggta ccaggggc                    288
//


spacer
spacer