spacer

EBI Dbfetch

ID   AJ300765; SV 1; linear; genomic DNA; STD; HUM; 302 BP.
XX
AC   AJ300765;
XX
DT   18-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, Cw*01 allele, exon
DE   2
XX
KW   HLA-C gene; HLA-Cw*01 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-302
RA   Bengtsson M.;
RT   ;
RL   Submitted (16-JAN-2001) to the INSDC.
RL   Bengtsson M., Dept of Oncology, Radiology and Clinical Immunology, Section
RL   of Clinical Immunology, Rudbeck Laboratory, University Hospital, SE-751 85
RL   Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new HLA C*01 variant";
RL   Unpublished.
XX
DR   MD5; c5049529f66f4764d1d9e7429ac7ff0b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..302
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <16..285
FT                   /gene="HLA-C"
FT                   /note="Cw*01 allele"
FT   CDS             <16..>285
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="Cw*01 allele"
FT                   /db_xref="GOA:Q9BD09"
FT                   /db_xref="IMGT/HLA:C*01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD09"
FT                   /protein_id="CAC24483.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEA"
FT   exon            16..285
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*01 allele"
XX
SQ   Sequence 302 BP; 57 A; 99 C; 104 G; 42 T; 0 other;
     cctcctcgcc cccaggctcc cactccatga agtatttctt cacatccgtg tcccggcctg        60
     gccgcggaga gccccgcttc atctcagtgg gctacgtgga cgacacgcag ttcgtgcggt       120
     tcgacagcga cgccgcgagt ccgagagggg agccgcgggc gccgtgggtg gagcaggagg       180
     ggccggagta ttgggaccgg gagacacaga agtacaagcg ccaggcacag actgaccgag       240
     tgagcctgcg gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc       300
     cc                                                                      302
//


spacer
spacer