spacer

EBI Dbfetch

ID   AJ300181; SV 2; linear; genomic DNA; STD; HUM; 3099 BP.
XX
AC   AJ300181;
XX
DT   06-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*15170101 allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*15170101 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (03-NOV-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.;
RT   "HLA B*15170101 variant with differences in exon 2";
RL   Unpublished.
XX
RN   [3]
RP   1-3099
RA   Cox S.T.;
RT   ;
RL   Submitted (05-JUN-2006) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 474159209d556d490785e0b381d763b8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3099
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,202..471,717..992,1568..1843,1948..2064,
FT                   2506..2538,2645..>2688)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101 allele"
FT   CDS             join(1..73,202..471,717..992,1568..1843,1948..2064,
FT                   2506..2538,2645..2688)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101 allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q9GIX2"
FT                   /db_xref="IMGT/HLA:B*15:17:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIX2"
FT                   /protein_id="CAC15502.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGCDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=1
FT   intron          74..201
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=1
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=2
FT   intron          472..716
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=2
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=3
FT   intron          993..1567
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=3
FT   exon            1568..1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=4
FT   intron          1844..1947
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=4
FT   exon            1948..2064
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=5
FT   intron          2065..2505
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=5
FT   exon            2506..2538
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=6
FT   intron          2539..2644
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=6
FT   exon            2645..>2688
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15170101"
FT                   /number=7
XX
SQ   Sequence 3099 BP; 570 A; 891 C; 990 G; 648 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgtgggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacccgggg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatcg cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga ggatggcgcc ccgggcgcca tggatagagc       360
     aggaggggcc ggagtattgg gaccgggaga cacggaacat gaaggcctcc gcgcagactt       420
     accgagagaa cctgcggatc gcgctccgct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cccccctgag gccgcgggac ccgcccaaac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcggggcctg ggccagggtc       720
     tcacaccctc cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gtaccaccag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc       840
     ctggaccgcg gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1200
     acagtcccta ggatagtgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1260
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1440
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1500
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1560
     ccatcagacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      1860
     gggtcatatc tgttctcagg gaaagcagga gcccttctgg agcccttcag cagggtcagg      1920
     gcccctcatc ttcccctcct ttcccagagc catcttccca gtccaccatc cccatcgtgg      1980
     gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg gtcgctactg      2040
     tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc tgggttttct      2100
     tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt actgggaagc      2160
     agcatccaca caggggctaa cgcagcctgg gaccctgtgt gccagcactt actcttttgt      2220
     gcagcacatg tgacaatgaa ggacagatgt atcgccttga tggttgtggt gttggggtcc      2280
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2340
     gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgccct gggtctgtag      2400
     tcatacttct ggaaattcct tttggttcca agacgaggag gttcctctaa gatctcatgg      2460
     tcctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga aaaggaggga      2520
     gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tgaagaagct cacccacccc      2580
     ataattcctc ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt ttgttctact      2640
     ccagccagcg acagtgccca gggctgtgat gtgtctctca cagcttgaaa aggtgagatt      2700
     cttggggtct agagtgggtg gggtggcggg tctgggggtg ggtggggcag tggggaaagg      2760
     cctgggtaat ggagattctt tgattgggat gtttcgcgtg tgtcgtgggc tgttcagagt      2820
     gtcatcactt accatgacta accagaattt gttcatgact gttgttttct gtagcctgag      2880
     acagctgtct tgtgagggac cgagatgcag gatttcttca cgcctcccct ttgtgacttc      2940
     aagagcctct ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc cctgttagca      3000
     taatgtgagg aggtggagag acagcccacc cttgtgtcca ctgtgacccc tgttcgcatg      3060
     ctgacctgtg tttcctcccc agaagcttgc ggaagggcg                             3099
//


spacer
spacer