spacer

EBI Dbfetch

ID   AJ300180; SV 2; linear; genomic DNA; STD; HUM; 3090 BP.
XX
AC   AJ300180;
XX
DT   06-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*40060101 allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*40060101 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (03-NOV-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Variant B*40060101 with difference in exon 2";
RL   Unpublished.
XX
RN   [3]
RP   1-3090
RA   Cox S.T.;
RT   ;
RL   Submitted (05-JUN-2006) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 37877596d2266cae37ad63a193821c13.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3090
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..>2677)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT   CDS             join(1..73,203..472,717..992,1568..1843,1937..2053,
FT                   2495..2527,2634..2677)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q04826"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*40:06:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04826"
FT                   /protein_id="CAC15501.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=1
FT   intron          74..202
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=2
FT   intron          473..716
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=2
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=3
FT   intron          993..1567
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=3
FT   exon            1568..1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=4
FT   intron          1844..1936
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=4
FT   exon            1937..2053
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=5
FT   intron          2054..2494
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=5
FT   exon            2495..2527
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=6
FT   intron          2528..2633
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=6
FT   exon            2634..>2677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101"
FT                   /number=7
XX
SQ   Sequence 3090 BP; 571 A; 881 C; 992 G; 646 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc       600
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       660
     tggtcggggc ggggcggggc tcggggggac ggggctgacc gcgggggcgg ggccagggtc       720
     tcacacttgg cagacgatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtgt       900
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1080
     ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1140
     ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat ggaggggaag      1200
     acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc ttgggaaccg      1260
     tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg ggctctgatt      1320
     ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc ctgttccccg      1380
     ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc gtccaggctg      1440
     gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc aggctggtca      1500
     catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt ctgactcttc      1560
     ccatcagacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga gggggatgag      1860
     gggtcatatc tcttctcagg gaaagcagga gcccttcagc agggtcaggg cccctcatct      1920
     tcccttcctt tcccagagcc gtcttcccag tccaccgtcc ccatcgtggg cattgttgct      1980
     ggcctggctg tcctagcagt tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg      2040
     aggaagagct caggtaggga aggggtgagg ggtggggtct gagttttctt gtcccactgg      2100
     gggtttcaag ccccaggtag aagtgttccc tgcctcatta ctgggaagca gcatccacac      2160
     aggggctaac gcagcctggg accctgtgtg ccagaactta ctcttttgtg cagcacatgt      2220
     gacaatgaag gacggatgta tcaccttggt ggttgtggtg ttggggtcct gattccagca      2280
     ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag ttggtccagg      2340
     acccacactt gctttcctcg tgtttcctga tcctgccttg ggtctgtagt catacttctg      2400
     gaaattcctt ttgggtccaa gacgaggagg ttcctctaag atctcatggc cctgcttcct      2460
     cccagtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag ctactctcag      2520
     gctgcgtgta agtgatgggg gtgggagtgt ggaggagctc acccaccccc taattcctcc      2580
     tgtcccacgt ctcctgcggg ctctgaccag gtcctgtttt tgttctactc caggcagcga      2640
     cagtgcccag ggctctgatg tgtctctcac agcttgaaaa ggtgagattc ttggggtcta      2700
     gagtgggtgg ggtggcaggt ctgggggtgg gtggggcagt ggggaaaggc ctgggtaatg      2760
     gagattcttt gattgggatg tttcgcgtgt gtggtgggct gtttagactg tcatcactta      2820
     ccatgactaa ccagaatttg ttcatgactg ttgttttctg tagcctgaga cagctgtctt      2880
     gtgagggact gagatgcagg atttcttcac gcctcccctt tgtgacttca agagcctctg      2940
     gcatctcttt ctgcaaaggc acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga      3000
     ggtggagaga ccagcccacc cccgtgtcca ctgtgacccc tgttcgcatg ctgacctgtg      3060
     tttcctcccc agaagcttgc ggaagggcga                                       3090
//


spacer
spacer