spacer

EBI Dbfetch

ID   AJ298282; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ298282;
XX
DT   11-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, B*15 variant
DE   allele, exon 2 and joined CDS
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Day S.;
RT   ;
RL   Submitted (09-JAN-2001) to the INSDC.
RL   Day S., H and I Reference Laboratory, National Blood Service, Southmead
RL   Hospital, BS10 5NB, UNITED KINGDOM.
XX
RN   [2]
RA   Smile D., Day S.;
RT   "Identification of new B*15 variant allele";
RL   Unpublished.
XX
DR   MD5; 230582915bdd728c541c155d571eaecc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ298289.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presententing molecule"
FT                   /note="B*15 variant allele"
FT                   /db_xref="GOA:Q9GIK6"
FT                   /db_xref="IMGT/HLA:B*15:69"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIK6"
FT                   /protein_id="CAC21575.2"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*15 variant allele"
XX
SQ   Sequence 270 BP; 59 A; 85 C; 90 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer