Dbfetch

ID   AJ297942; SV 2; linear; genomic DNA; STD; HUM; 2235 BP.
XX
AC   AJ297942; AJ297943;
XX
DT   13-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele B*44
DE   variant (B*44AKA), exons 1-4
XX
KW   alpha 1 domain; HLA-B gene; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-NOV-2000) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2002.600113.x.
RX   PUBMED; 12366789.
RA   Przemeck M., Elsner H.A., Sel S., Pastucha L.T., Blasczyk R.;
RT   "HLA-B*4431: a new HLA-B variant with a complex ancestral history involving
RT   HLA-B*44, B*40 and B*07 alleles";
RL   Tissue Antigens 60(1):91-94(2002).
XX
RN   [3]
RP   1-2235
RA   Blasczyk R.;
RT   ;
RL   Submitted (30-JAN-2002) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
DR   MD5; a3376f1e31e5074dc97af32b8b866ea4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2235
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="MHH006341"
FT                   /mol_type="genomic DNA"
FT                   /country="Turkey"
FT                   /sex="female"
FT                   /cell_line="AK1965"
FT                   /cell_type="EBV transformed B-lymphocytes"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,504..773,1017..1292,1867..>2142)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="B*44 variant (B*44AKA) allele"
FT                   /db_xref="IMGT/HLA:B*44:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIX4"
FT                   /protein_id="CAC16173.2"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVESLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*44 variant (B*44AKA) allele"
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*44 variant (B*44AKA) allele"
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*44 variant (B*44AKA) allele"
FT   intron          774..1016
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*44 variant (B*44AKA) allele"
FT   exon            1017..1292
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*44 variant (B*44AKA) allele"
FT   intron          1293..1866
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*44 variant (B*44AKA) allele"
FT   exon            1867..2142
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*44 variant (B*44AKA) allele"
FT   intron          2143..>2235
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*44 variant (B*44AKA) allele"
XX
SQ   Sequence 2235 BP; 425 A; 699 C; 714 G; 397 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agggccgcgt ctgcaatggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccattt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gccggtgagt gcggggtcgg gagggaaatg gcctctgtgg ggaggagaga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt       600
     cgtgaggttc gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcccccgag gccgcgggac ccgcccagac cctcgaccgg       900
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       960
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggccgg ggccagggtc      1020
     tcacaccctc cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg      1080
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc      1140
     ctggaccgcc gcggacacgg cggctcagat ctcccagcgc aagttggagg cggcccgtgt      1200
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtcgctcc gcagatacct      1260
     ggagaacggg aaggacaagc tggagcgcgc tggtaccagg ggcagtgggg agccttcccc      1320
     atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat gggatcagcg      1380
     ctagaatgtc gccctccgtt gaatggagaa tggcatgagt tttcctgagt ttcctctgag      1440
     ggccccctct tctctctaga caattaagga atgacgtctc tgaggaaatg gaggggaaga      1500
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1560
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1620
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1680
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1740
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1800
     atgggtggtc ctagggtgtc ccatgaaaga tgcaaagcgc ctgaattttc tgactcttcc      1860
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1920
     tgaggtgctg ggccctgggt ttctaccctg cggagatcac actgacctgg cagcgggatg      1980
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      2040
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      2100
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      2160
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      2220
     cccctccttt cccag                                                       2235
//