spacer

EBI Dbfetch

ID   AJ297587; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AJ297587;
XX
DT   16-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for MHC class II antigen (HLA-DRB1 gene), DRB1*11041
DE   allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*11041 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RA   Corell A.;
RT   ;
RL   Submitted (15-AUG-2000) to the INSDC.
RL   Corell A., HLA Informatics Group, Anthony Nolan Research Institute, The
RL   Royal Free Hospital, Pond Street, Hampstead, NW3 2QG London, UNITED
RL   KINGDOM.
XX
RN   [2]
RA   Ramon D., Corell A., Cox S.T., Madrigal J., Marsh S.G.E.;
RT   "Complete cDNA sequences of the HLA-DRB1*0402 and *11041 alleles";
RL   Unpublished.
XX
DR   MD5; a5272fd96f877163b490e6db415984a7.
DR   H-InvDB; HIT000246754_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="United Kingdom"
FT                   /sex="male"
FT                   /haplotype="HLA-A*01, B*35, DRB1*11041"
FT                   /clone="FPAF-L7"
FT                   /cell_line="FPAF"
FT                   /cell_type="EBV transformed B lymphocyte"
FT                   /tissue_lib="ECACC"
FT                   /db_xref="taxon:9606"
FT   CDS             1..801
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*11041 allele"
FT                   /db_xref="GOA:P20039"
FT                   /db_xref="H-InvDB:HIT000246754_05.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*11:04:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20039"
FT                   /protein_id="CAC08827.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   sig_peptide     1..87
FT                   /gene="HLA-DRB1"
FT                   /note="DRB1*11041 allele"
FT   mat_peptide     88..798
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*11041 allele"
XX
SQ   Sequence 801 BP; 172 A; 199 C; 258 G; 172 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tataaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       240
     gagctggggc ggcctgatga ggagtactgg aacagccaga aggacttcct ggaagacagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcctgagctg a                                                 801
//


spacer
spacer