spacer

EBI Dbfetch

ID   AJ297586; SV 2; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AJ297586;
XX
DT   16-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for MHC class II antigen (HLA-DRB1 gene), DRB1*0402
DE   allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*0402 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Revised by [3]
RA   Corell A.;
RT   ;
RL   Submitted (15-AUG-2000) to the INSDC.
RL   Corell A., HLA Informatics Group, Anthony Nolan Research Institute, The
RL   Royal Free Hospital, Pond Street, Hampstead, NW3 2QG London, UNITED
RL   KINGDOM.
XX
RN   [2]
RA   Ramon D., Corell A., Cox S.T., Madrigal J., Marsh S.G.E.;
RT   "Complete cDNA sequences of the HLA-DRB1*0402 and *11041 alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-801
RA   Corell A.;
RT   ;
RL   Submitted (27-AUG-2001) to the INSDC.
RL   Corell A., Departamento de Pediatria, Inmunologia, Obstetricia y
RL   ginecologia, Facultad de Medicina, Universidad de Valladolid, Avda Ramon y
RL   Cajal no. 7, 47005 Valladolid, SPAIN
XX
DR   MD5; b19fc16c24325dfac8b0cb0fe4c847b2.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="USA"
FT                   /haplotype="HLA-A*26, B*38, DRB1*0402"
FT                   /clone="FS-40L"
FT                   /cell_line="FS"
FT                   /cell_type="EBV transformed B lymphocyte"
FT                   /tissue_lib="ECACC"
FT                   /db_xref="taxon:9606"
FT   CDS             1..801
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*0402 allele"
FT                   /db_xref="GOA:P13760"
FT                   /db_xref="H-InvDB:HIT000246753_03.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*04:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1D5M"
FT                   /db_xref="PDB:1D5X"
FT                   /db_xref="PDB:1D5Z"
FT                   /db_xref="PDB:1D6E"
FT                   /db_xref="PDB:1J8H"
FT                   /db_xref="PDB:2SEB"
FT                   /db_xref="PDB:3O6F"
FT                   /db_xref="PDB:3T0E"
FT                   /db_xref="PDB:4IS6"
FT                   /db_xref="PDB:4MCY"
FT                   /db_xref="PDB:4MCZ"
FT                   /db_xref="PDB:4MD0"
FT                   /db_xref="PDB:4MD4"
FT                   /db_xref="PDB:4MD5"
FT                   /db_xref="PDB:4MDI"
FT                   /db_xref="PDB:4MDJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13760"
FT                   /protein_id="CAC08826.2"
FT                   /translation="MVCLKFPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECH
FT                   FFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDERAAV
FT                   DTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   sig_peptide     1..87
FT                   /gene="HLA-DRB1"
FT                   /note="DRB1*0402 allele"
FT   mat_peptide     88..798
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*0402 allele"
XX
SQ   Sequence 801 BP; 174 A; 205 C; 258 G; 164 T; 0 other;
     atggtgtgtc tgaagttccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccgac cacgtttctt ggagcaggtt       120
     aaacatgagt gtcatttctt caacgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacatcct ggaagacgag       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gcttcgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//


spacer
spacer