spacer

EBI Dbfetch

ID   AJ297585; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AJ297585;
XX
DT   16-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for MHC class II antigen (HLA-DRB1 gene), DRB1*1404
DE   allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*1404 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RA   Corell A.;
RT   ;
RL   Submitted (15-AUG-2000) to the INSDC.
RL   Corell A., HLA Informatics Group, Anthony Nolan Research Institute, The
RL   Royal Free Hospital, Pond Street, Hampstead, NW3 2QG London, UNITED
RL   KINGDOM.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2002.590116.x.
RX   PUBMED; 11972886.
RA   Corell A., Cox S.T., Soteriou B., Ramon D., Madrigal J.A., Marsh S.G.E.;
RT   "Complete cDNA sequences of the HLA-DRB1*14011, *1402, *1403 and *1404
RT   alleles";
RL   Tissue Antigens 59(1):66-69(2002).
XX
DR   MD5; b1d2e7d7f4eb09b35e00f9d0f8b5ffce.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
DR   H-InvDB; HIT000246752_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="USA"
FT                   /haplotype="HLA-A11, B35, DRB1*14"
FT                   /clone="KGU-L3"
FT                   /cell_line="KGU"
FT                   /cell_type="EBV transformed B lymphocytes"
FT                   /tissue_lib="ECACC"
FT                   /db_xref="taxon:9606"
FT   CDS             1..801
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*1404 allele"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="H-InvDB:HIT000246752_05.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAC08825.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVTELGRPAAEHWNSQKDLLERRRAEV
FT                   DTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   sig_peptide     1..87
FT                   /gene="HLA-DRB1"
FT                   /note="DRB1*1404 allele"
FT   mat_peptide     88..798
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*1404 allele"
XX
SQ   Sequence 801 BP; 168 A; 199 C; 264 G; 170 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgggtgagt gttatttctt caatgggacg gagcgggtgc ggttcctgga cagatacttc       180
     cataaccagg aggagttcgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgctgc ggagcactgg aacagccaga aggacctcct ggagcggagg       300
     cgggccgagg tggacaccta ttgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctgc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcctgagctg a                                                 801
//


spacer
spacer