spacer

EBI Dbfetch

ID   AJ297584; SV 1; linear; mRNA; STD; HUM; 793 BP.
XX
AC   AJ297584;
XX
DT   16-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial mRNA for MHC class II antigen (HLA-DRB1 gene),
DE   DRB1*1403 allele
XX
KW   HLA-DRB1 gene; HLA-DRB1*1403 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-793
RA   Corell A.;
RT   ;
RL   Submitted (15-AUG-2000) to the INSDC.
RL   Corell A., HLA Informatics Group, Anthony Nolan Research Institute, The
RL   Royal Free Hospital, Pond Street, Hampstead, NW3 2QG London, UNITED
RL   KINGDOM.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2002.590116.x.
RX   PUBMED; 11972886.
RA   Corell A., Cox S.T., Soteriou B., Ramon D., Madrigal J.A., Marsh S.G.E.;
RT   "Complete cDNA sequences of the HLA-DRB1*14011, *1402, *1403 and *1404
RT   alleles";
RL   Tissue Antigens 59(1):66-69(2002).
XX
DR   MD5; 119ce7fb5ece94be6063536dc99c3aa5.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..793
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /country="Japan"
FT                   /clone="MI-S6"
FT                   /cell_line="MI"
FT                   /cell_type="EBV transformed B lymphocytes"
FT                   /tissue_lib="ECACC"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>793
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*1403 allele"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:03:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAC08824.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEDRRALV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGF"
FT   sig_peptide     1..87
FT                   /gene="HLA-DRB1"
FT                   /note="DRB1*1403 allele"
FT   mat_peptide     88..>793
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*1403 allele"
XX
SQ   Sequence 793 BP; 170 A; 201 C; 255 G; 167 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga gagatacttc       180
     cataaccagg aggagaacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgatgc cgagtactgg aacagccaga aggacctcct ggaagacagg       300
     cgggccctgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcc                                                          793
//


spacer
spacer