Dbfetch

ID   AJ297503; SV 1; linear; genomic DNA; STD; HUM; 282 BP.
XX
AC   AJ297503;
XX
DT   25-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB4 gene for human leucocyte antigen DRB4 isolate
DE   GL-CV, exon 3
XX
KW   HLA-DRB4 gene; human leucocyte antigen DRB4;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (01-AUG-2000) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New HLA DRB4 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; c97203e130626aba3c94762bf84d8ed6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="GL-CV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=3
FT                   /gene="HLA-DRB4"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB4"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:03"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD10"
FT                   /protein_id="CAC27124.1"
FT                   /translation="QPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKA
FT                   GVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQW"
FT   exon            1..282
FT                   /gene="HLA-DRB4"
FT                   /number=3
XX
SQ   Sequence 282 BP; 67 A; 75 C; 81 G; 59 T; 0 other;
     tccaacctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac cacaacctcc        60
     tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg ttccggaacg       120
     gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga gactggacct       180
     tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac acctgccaag       240
     tggagcatcc aagcatgatg agccctctca cggtgcaatg ga                          282
//