spacer

EBI Dbfetch

ID   AJ297499; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ297499;
XX
DT   25-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for human leucocyte antigen A, new A*34A
DE   allele, exon 2 and joined CDS
XX
KW   HLA-A gene; human leucocyte antigen A; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (01-AUG-2000) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., Hepkema B., Lems S., van den Berg-Loonen E.M.;
RT   "New A*34 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; fde36f21762ffb9ce4549c21ce1b4fb0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="TDG"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ297500.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen A"
FT                   /function="antigen presenting molecule"
FT                   /note="new A*34A allele"
FT                   /db_xref="GOA:Q9BD11"
FT                   /db_xref="IMGT/HLA:A*34:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD11"
FT                   /protein_id="CAC27241.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="new A*34A allele"
XX
SQ   Sequence 270 BP; 54 A; 84 C; 95 G; 37 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer