spacer

EBI Dbfetch

ID   AJ297317; SV 1; linear; genomic DNA; STD; HUM; 3135 BP.
XX
AC   AJ297317;
XX
DT   12-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*38021 allele, exons 1-7
XX
KW   B*38021 allele; HLA-B gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3135
RA   Cox S.T.;
RT   ;
RL   Submitted (12-JAN-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA-B*38021";
RL   Unpublished.
XX
DR   MD5; f2d7d84afacf015f1524b5577933f4a6.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3135
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="full genomic confirmation of HLA-B*38021 from rare
FT                   cell exchange cell Terasaki 58"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..2675)
FT                   /gene="HLA-B"
FT                   /note="B*38021 allele"
FT   CDS             join(1..73,202..471,718..993,1566..1841,1935..2051,
FT                   2493..2525,2632..2675)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentating molecule"
FT                   /note="B*38021 allele"
FT                   /db_xref="GOA:Q95365"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*38:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95365"
FT                   /protein_id="CAC29063.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*38021 allele"
FT   intron          74..201
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*38021 allele"
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*38021 allele"
FT   intron          472..717
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*38021 allele"
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*38021 allele"
FT   intron          994..1565
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*38021 allele"
FT   exon            1566..1841
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*38021 allele"
FT   intron          1842..1934
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*38021 allele"
FT   exon            1935..2051
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*38021 allele"
FT   intron          2052..2492
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*38021 allele"
FT   exon            2493..2525
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*38021 allele"
FT   intron          2526..2631
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*38021 allele"
FT   exon            2632..2675
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*38021 allele"
XX
SQ   Sequence 3135 BP; 592 A; 901 C; 985 G; 657 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggaatattgg gaccggaaca cacagatctg caagaccaac acacagactt       420
     accgagagaa cctgcgcacc gcgctccgct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacaccct ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg       780
     ggcataacca gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca gctgagaacc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc caacgagaag aagaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     atgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc tctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag attatcccag gtgcctgcgt ccaggctggt      1440
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1500
     tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc tgaattttct gactcttccc      1560
     atcagacccc ccaaagacac atgtgaccca ccaccccatc tctgaccatg aggccaccct      1620
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     cgaggaccaa actcaggaca ccgagcttgt ggagaccaga ccagcaggag acagaacctt      1740
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt      1800
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      1860
     gtcatatctc ttctcaggga aagcaggagc ccttcagcag ggtcagggcc cctcatcttc      1920
     ccctcctttc ccagagccat cttcccagtc caccgtcccc atcgtgggca ttgttgctgg      1980
     cctggctgtc ctagcagttg tggtcatcgg agctgtggtc gctgctgtga tgtgtaggag      2040
     gaagagttca ggtagggaag gggtgagggg tggggtctgg gttttcttgt cccactgggg      2100
     gtttcaagcc ccaggtagaa gtgttccctg catcattact gggaagcagc atgcacacag      2160
     gggctaacgc agcctgggac cctgtgtgcc agcacttact cttttgtgca gcacatgtga      2220
     caatgaagga cggatgtatc accttgatgg ttgtggtgtt ggggtcctga ttccagcatt      2280
     catgagtcag gggaaggtcc ctgctaagga cagaccttag gagggcagtt ggtccaggac      2340
     ccacacttgc tttcctcgtg tttcctgatc ctgccctggg tctgtagtca tacttctgga      2400
     aattcctttt gggtccaaga ctaggaggtt cctctaagat ctcatggccc tgcttcctcc      2460
     cagtcccctc acaggacatt ttcttcccac aggtggaaaa ggagggagct actctcaggc      2520
     tgcgtgtaag tggtgggggt gggagtgtgg aggagctcac ccaccccata attcctcctg      2580
     tcccacgtct cctgtgggct ctgaccaggt cctgtttttg ttctactcca gccagcgaca      2640
     gtgcccaggg ctctgatgtg tctctcacag cttgaaaagg tgagattctt ggggtctaga      2700
     gtgggcgggg gggcggggag ggggcagagg ggaaaggcct gggtaatgga gattctttga      2760
     ttgggatgtt tcgcgtgtgt gatgggctgt tcagagtgtc atcacttacc atgactaacc      2820
     agaatttgtt catgactgtt gttttctgta gcctgagaca gctgtcttgt gagggactga      2880
     gatgcaggat ttcttcacgc ctcccctttg tgacttcaag agcctctggc atctctttct      2940
     gcaaaggcac ctgaatgtgt ctgcgtccct gttagcataa tgtgaggagg tggagagaca      3000
     gcccaccctt gtgtccactg tgacccctgt tcgcatgctg acctgtgttt cctccccaga      3060
     agcttgcgaa gggcgaattc cagcacactg gcggccgtta ctagtggatc cgagctcggt      3120
     accaagcttg atgca                                                       3135
//


spacer
spacer