spacer

EBI Dbfetch

ID   AJ297266; SV 1; linear; genomic DNA; STD; HUM; 234 BP.
XX
AC   AJ297266;
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1* gene for HLA-DR molecule, exon 2
XX
KW   HLA-DR molecule; HLA-DRB1 gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-234
RA   Gagne K.;
RT   ;
RL   Submitted (21-DEC-2000) to the INSDC.
RL   Gagne K., HLA, Blood bank, 34 BOULEVARD JEAN MONNET, Nantes 44011, FRANCE.
XX
RN   [2]
RA   Gagne K.;
RT   "New DRB1*03 allele identified";
RL   Unpublished.
XX
DR   MD5; 6f515d29f856cb36a7c4b5b7c35ef24f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..234
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="patient#17839"
FT                   /mol_type="genomic DNA"
FT                   /country="France:Nantes"
FT                   /sex="male"
FT                   /haplotype="A1"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>234
FT                   /gene="HLA-DRB1*"
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1*"
FT                   /product="HLA-DR molecule"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q9GIL1"
FT                   /db_xref="IMGT/HLA:DRB1*03:21"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIL1"
FT                   /protein_id="CAC19573.2"
FT                   /translation="ECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEFRAVTELGRPDA
FT                   EYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTX"
FT   exon            <1..>234
FT                   /gene="HLA-DRB1*"
FT                   /number=2
XX
SQ   Sequence 234 BP; 50 A; 54 C; 88 G; 41 T; 1 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac        60
     caggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgccgagta ctggaacagc cagaaggacc tcctggagca gaagcggggc       180
     cgggtggaca actactgcag acacaactac ggggttgtgg agagcttcac agyg             234
//


spacer
spacer