spacer

EBI Dbfetch

ID   AJ296092; SV 3; linear; genomic DNA; STD; HUM; 1381 BP.
XX
AC   AJ296092; AJ296091;
XX
DT   29-SEP-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens partial HLA-DQA1 gene for MHC class II antigen, exon 1-4
XX
KW   HLA-DQA1 gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Updated by [3]
RP   1-82
RA   Perez-Rodriguez M.;
RT   ;
RL   Submitted (29-SEP-2000) to the INSDC.
RL   Perez-Rodriguez M., Research Institute, The Anthony Nolan Bone Marrow
RL   Trust, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2002.590516.x.
RX   PUBMED; 12144633.
RA   Perez-Rodriguez M., Madrigal A., Marsh S.G.E.;
RT   "A novel HLA-DQA1 allele, DQA1*01042";
RL   Tissue Antigens 59(5):440-442(2002).
XX
RN   [3]
RC   revised by [4]
RA   Marsh S.G.E.;
RT   ;
RL   Submitted (13-JAN-2005) to the INSDC.
RL   Marsh S.G.E., Research Institute, The Anthony Nolan Bone Marrow Trust, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 2e27e1cc01d32afb44ae35130851b9ef.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1381
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A11,B35,Cw4,DRB1*1404"
FT                   /cell_line="KGU"
FT                   /cell_type="B-lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..82,183..431,845..1126,1227..1381)
FT                   /gene="HLA-DQA1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5Y7C9"
FT                   /db_xref="IMGT/HLA:DQA1*01:04:02"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5Y7C9"
FT                   /protein_id="CAC88114.2"
FT                   /translation="MILNKALLLGALALTTMMSPCGGEGIVADHVASCGVNLYQFYGPS
FT                   GQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYN
FT                   STAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSF
FT                   LSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCT
FT                   LGLSVGLVGIVVGTVFIIQGLRSVGASRHQGPL"
FT   exon            1..82
FT                   /gene="HLA-DQA1"
FT                   /number=1
FT   gap             83..182
FT                   /estimated_length=unknown
FT   exon            183..431
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   intron          432..844
FT                   /gene="HLA-DQA1"
FT                   /number=2
FT   exon            845..1126
FT                   /gene="HLA-DQA1"
FT                   /number=3
FT   gap             1127..1226
FT                   /estimated_length=unknown
FT   exon            1227..1381
FT                   /gene="HLA-DQA1"
FT                   /number=4
XX
SQ   Sequence 1381 BP; 278 A; 308 C; 280 G; 315 T; 200 other;
     atgatcctaa acaaagctct gctgctgggg gccctcgctc tgaccaccat gatgagccct        60
     tgtggaggtg aaggcattgt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnctgaccac gttgcctctt gtggtgtaaa cttgtaccag ttttacggtc cctctggcca       240
     gtacacccat gaatttgatg gagatgagga gttctacgtg gacctggaga ggaaggagac       300
     tgcctggcgg tggcctgagt tcagcaaatt tggaggtttt gacccgcagg gtgcactgag       360
     aaacatggct gtggcaaaac acaacttgaa catcatgatt aaacgctaca actctaccgc       420
     tgctaccaat ggtatgcgtc caccattctg cctctcttta cttaagctat ccctccatac       480
     cagggttcat tattttcttc ccaagaggtc cccagatctt cttatggcaa ttgctgaaat       540
     tttatcatct cccatctcta aaatcacata ttcccatgta atacaagggt ctttccatta       600
     tgcattcagc aaatccttct aggagaggtc tcatcaacct cctactttat taaacatgcc       660
     cacagagaga agggcacagg aataaagcag aggcaatgtg tcgttgctcc caagcagaag       720
     gtaaataaga cctctttgac tatcaggtgg tgaaatgctg gtaggagggc tcttccagga       780
     tgtaatgcag aacttcaggg cagagctatt cacacttcac accagtgctg tttcctcacc       840
     acagaggttc ctgaggtcac agtgttttcc aagtctcccg tgacactggg tcagcccaac       900
     accctcattt gtcttgtgga caacatcttt cctcctgtgg tcaacatcac ctggctgagc       960
     aatgggcagt cagtcacaga aggtgtttct gagaccagct tcctctccaa gagtgatcat      1020
     tccttcttca agatcagtta cctcaccttc ctcccttctg ctgatgagat ttatgactgc      1080
     aaggtggagc actggggcct ggaccagcct cttctgaaac actgggnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnagcc tgagattcca gcccctatgt cagagctcac      1260
     agagactgtg gtctgcaccc tggggttgtc tgtgggcctc gtgggcattg tggtgggcac      1320
     tgtcttcatc atccaaggcc tgcgttcagt tggtgcttcc agacaccaag ggccattgtg      1380
     a                                                                      1381
//


spacer
spacer