Dbfetch

ID   AJ295845; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ295845;
XX
DT   10-SEP-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*04032
DE   allele, exon 2
XX
KW   HLA-DR4 gene; HLA-DRB1*04032 allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (07-SEP-2000) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G., Hammond L.;
RT   "Confirmatory sequence of HLA-DRB1*04032";
RL   Unpublished.
XX
DR   MD5; 0cf72554721440444c44d16ec2768555.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="32891"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="HLA-DRB1*04032"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*04032 allele"
FT                   /db_xref="GOA:P13760"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*04:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1D5M"
FT                   /db_xref="PDB:1D5X"
FT                   /db_xref="PDB:1D5Z"
FT                   /db_xref="PDB:1D6E"
FT                   /db_xref="PDB:1J8H"
FT                   /db_xref="PDB:2SEB"
FT                   /db_xref="PDB:3O6F"
FT                   /db_xref="PDB:3T0E"
FT                   /db_xref="PDB:4IS6"
FT                   /db_xref="PDB:4MCY"
FT                   /db_xref="PDB:4MCZ"
FT                   /db_xref="PDB:4MD0"
FT                   /db_xref="PDB:4MD4"
FT                   /db_xref="PDB:4MD5"
FT                   /db_xref="PDB:4MDI"
FT                   /db_xref="PDB:4MDJ"
FT                   /db_xref="PDB:4Y19"
FT                   /db_xref="PDB:4Y1A"
FT                   /db_xref="PDB:5JLZ"
FT                   /db_xref="PDB:5LAX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13760"
FT                   /protein_id="CAC08181.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1*04032"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 64 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//