spacer

EBI Dbfetch

ID   AJ295279; SV 1; linear; genomic DNA; STD; HUM; 3366 BP.
XX
AC   AJ295279;
XX
DT   24-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*13 null allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*13 null allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3366
RA   Dunn P.P.;
RT   ;
RL   Submitted (17-NOV-2000) to the INSDC.
RL   Dunn P.P., H & I Reference Laboratory, National Blood Service, Southmead
RL   Road, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Carter V., Dunn P.P.;
RT   "Identification of a HLA-B*13 null allele";
RL   Unpublished.
XX
DR   MD5; 95741caabf6b098f8a4b691e9cd0074c.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
CC   Related sequence: AJ295278
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3366
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(304..376,506..775,1021..1296,1872..2147,2252..2368,
FT                   2810..2842,2949..2992)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B13 null allele"
FT   CDS             join(304..376,506..775,1021..1296,1872..2147,2252..2368,
FT                   2810..2842,2949..2992)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B13 null allele"
FT                   /db_xref="GOA:P30461"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*13:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30461"
FT                   /protein_id="CAC17137.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRACLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   sig_peptide     304..306
FT                   /gene="HLA-B"
FT                   /note="HLA-B*13 null allele"
FT   exon            304..376
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="HLA-B*13 null allele"
FT   intron          377..505
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="HLA-B*13 null allele"
FT   mat_peptide     join(506..775,1021..1296,1872..2147,2252..2368,2810..2842,
FT                   2949..2992)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B*13 null allele"
FT   exon            506..775
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*13 null allele"
FT   intron          776..1020
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*13 null allele"
FT   exon            1021..1296
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*13 null allele"
FT   variation       1225
FT                   /replace="a"
FT                   /note="HLA-B*1302 allele"
FT                   /citation=[2]
FT   intron          1297..1871
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*13 null allele"
FT   exon            1872..2147
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="HLA-B*13 null allele"
FT   intron          2148..2251
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="HLA-B*13 null allele"
FT   exon            2252..2368
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="HLA-B*13 null allele"
FT   intron          2369..2809
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="HLA-B*13 null allele"
FT   exon            2810..2842
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="HLA-B*13 null allele"
FT   intron          2843..2948
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="HLA-B*13 null allele"
FT   exon            2949..2992
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="HLA-B*13 null allele"
XX
SQ   Sequence 3366 BP; 626 A; 974 C; 1056 G; 710 T; 0 other;
     gctggtgtag gagaagaggg atcaggacga agtcccaggt cccggacggg gctctcaggg        60
     tctcaggctc cgagagcctt gtctgcattg gggaggcgca gcgttgggga ttccccactc       120
     ccacgagttt cacttcttct cccaacctat gtcgggtcct tcttccagga tactcgtgac       180
     gcgtccccaa ttcccactcc cattgggtgt cgggtgtcta gagaagccaa tcagtgtcgc       240
     cggggtccca gttctaaagt ccccacgcac ccacccggac tcagaatctc ctcagacgcc       300
     gagatgcggg tcacggcgcc ccgaaccctc ctcctgctgc tctggggggc agtggccctg       360
     accgagacct gggccggtga gtgcgggatc gggagggaaa tggcctctgt ggggaggagc       420
     gaggggaccg caggcggggg cgcaggaccc ggggagccgc gccgggagga gggtctggcg       480
     ggtctcagcc cctcctggcc cccaggctcc cactccatga ggtatttcta caccgccatg       540
     tcccggcccg gccgcgggga gccccgcttc atcaccgtgg gctacgtgga cgacacccag       600
     ttcgtgaggt tcgacagcga cgccacgagt ccgaggatgg cgccccgggc gccatggata       660
     gagcaggagg ggccggagta ttgggaccgg gagacacaga tctccaagac caacacacag       720
     acttaccgag agaacctgcg caccgcgctc cgctactaca accagagcga ggccggtgag       780
     tgaccccggc ccggggcgca ggtcacgact ccccatcccc cacggacggc ccgggtcgcc       840
     ccgagtctcc gggtccgaga tccgcctccc tgaggccgcg ggacccgccc agaccctcga       900
     ccggcgagag ccccaggcgc gtttacccgg tttcattttc agttgaggcc aaaatccccg       960
     cgggttggtc ggggcggggc ggggctcggg ggacggggct gaccgcgggg ccggggccag      1020
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg cgcctcctcc      1080
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga      1140
     gctcctggac cgcggcggac accgcggctc agatcaccca gctcaagtgg gaggcggccc      1200
     gtgtggcgga gcagctgaga gcctgcctgg agggcgagtg cgtggagtgg ctccgcagat      1260
     acctggagaa cgggaaggag acgctgcagc gcgcgggtac caggggcagt ggggagcctt      1320
     ccccatctcc tataggtcgc cggggatggc ctcccacgag aagaggagga aaatgggatc      1380
     agcgctagaa tgtcgccctc ccttgaatgg agaatggcat gagttttcct gagtttcctc      1440
     tgagggcccc ctcttctctc taggacaatt aagggatgac gtctctgagg aaatgtaggg      1500
     gaagacagtc cctagaatac tgatcagggg tcccctttga cccctgcagc agccttggga      1560
     accgtgactt ttcctctcag gccttgttct ctgcctcaca ctcagtgtgt ttggggctct      1620
     gattccagca cttctgagtc actttacctc cactcagatc aggagcagaa gtccctgttc      1680
     cccgctcaga gactcgaact ttccaatgaa taggagatta tcccaggtgc ctgcgtccag      1740
     gctggtgtct gggttctgtg ccccttcccc accccaggtg tcctgtccat tctcaggctg      1800
     gtcacatggg tggtcctagg gtgtcccatg agagatgcaa agcgcctgaa ttttctgact      1860
     cttcccatca gaccccccaa agacacacgt gacccaccac cccatctctg accatgaggc      1920
     caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg      1980
     ggatggcgag gaccaaactc aggacactga gcttgtggag accagaccag caggagatag      2040
     aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga gatacacatg      2100
     ccatgtacag catgaggggc tgccgaagcc cctcaccctg agatggggta aggaggggga      2160
     tgaggggtca tatctcttct cagggaaagc aggagccctt ctggagccct tcagcagggt      2220
     cagggcccct catcttcccc tcctttccca gagccatctt cccagtccac cgtccccatc      2280
     gtgggcattg ttgctggcct ggctgtccta gcagttgtgg tcatcggagc tgtggtcgct      2340
     gctgtgatgt gtaggaggaa gagctcaggt agggaagggg tgaggggtgg ggtctgggtt      2400
     ttcttgtccc actgggggtt tcaagcccca ggtagaagtg ttccctgcct cattactggg      2460
     aagcagcatg cacacagggg ctaacgcaga ctgggaccct gtgtgccagc acttactctt      2520
     ttgtgcagca catgtgacaa tgaagcacgg atgtatcacc ttgatggttg tggtgttggg      2580
     gtcctgattc cagcattcat gagtcagggg aaggtccctg ctaaggacag accttaggag      2640
     ggcagttggt ccaggaccca cacttgcttt cctcgtgttt cctgatcctg ccctgggtct      2700
     gtagtcatac ttctggaaat tccttttggg tccaagacta ggaggttcct ctaagatctc      2760
     atggccctgc ttcctcccag tcccctcaca ggacattttc ttcccacagg tggaaaagga      2820
     gggagctact ctcaggctgc gtgtaagtgg tgggggtggg agtgtggagg agctcaccca      2880
     ccccataatt cctcctgtcc cacgtctcct gcgggctctg accaggtcct gtttttgttc      2940
     tactccaggc agcgacagtg cccagggctc tgatgtgtct ctcacagctt gaaaaggtga      3000
     gattcttggg gtctagagtg ggcggggggg gtggtggggc agaggggaaa ggcctgggta      3060
     atggacattc tttgattggg atgtttcgcg tgtgtggtgg gctgtttaga gtgtcatcac      3120
     ttaccatgac taaccagaat ttgttcatga ctgttgtttt ctgtagcctg agacagctgt      3180
     cttgtgaggg accgagatgc aggatttctt cacgcctccc ctttgtgact tcaagagcct      3240
     ctggcatctc tttctgcaaa ggcacctgaa tgtgtctgtg tccctgttag cataatgtga      3300
     ggaggtggag agacagccca actgtgtgtc cactgtgacc cctgttccca tgctgacctg      3360
     tgttct                                                                 3366
//


spacer
spacer