spacer

EBI Dbfetch

ID   AJ295278; SV 1; linear; genomic DNA; STD; HUM; 3372 BP.
XX
AC   AJ295278;
XX
DT   24-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, B*1302 allele, exons 1-7
XX
KW   HLA B13 antigen; HLA-B gene; HLA-B*1302 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3372
RA   Dunn P.P.;
RT   ;
RL   Submitted (17-NOV-2000) to the INSDC.
RL   Dunn P.P., H & I Reference Laboratory, National Blood Service, Southmead
RL   Road, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Carter V., Dunn P.P.;
RT   "Identification of a B*13 null allele";
RL   Unpublished.
XX
DR   MD5; 39387d207cfb905309d592ee0a19f6e5.
XX
CC   Related sequence: AJ295279
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3372
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(310..382,512..781,1027..1302,1878..2153,2258..2374,
FT                   2816..2848,2955..2998)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B*1302 allele"
FT   CDS             join(310..382,512..781,1027..1302,1878..2153,2258..2374,
FT                   2816..2848,2955..2998)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B*1302 allele"
FT                   /db_xref="GOA:Q546P4"
FT                   /db_xref="IMGT/HLA:B*13:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546P4"
FT                   /protein_id="CAC17136.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   sig_peptide     310..382
FT                   /gene="HLA-B"
FT                   /note="HLA-B*1302 allele"
FT   exon            310..382
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="HLA-B*1302 allele"
FT   intron          383..511
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="HLA-B*1302 allele"
FT   mat_peptide     join(512..781,1027..1302,1878..2153,2258..2374,2816..2848,
FT                   2955..2998)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B*1302 allele"
FT   exon            512..781
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*1302 allele"
FT   intron          782..1026
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*1302 allele"
FT   exon            1027..1302
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*1302 allele"
FT   variation       1231
FT                   /replace="g"
FT                   /note="HLA-B*13 null allele"
FT                   /citation=[2]
FT   intron          1303..1877
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*1302 allele"
FT   exon            1878..2153
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="HLA-B*1302 allele"
FT   intron          2154..2257
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="HLA-B*1302 allele"
FT   exon            2258..2374
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="HLA-B*1302 allele"
FT   intron          2375..2815
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="HLA-B*1302 allele"
FT   exon            2816..2848
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="HLA-B*1302 allele"
FT   intron          2849..2954
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="HLA-B*1302 allele"
FT   exon            2955..2998
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="HLA-B*1302 allele"
XX
SQ   Sequence 3372 BP; 631 A; 974 C; 1057 G; 710 T; 0 other;
     aaagaggctg gtgtaggaga agagggatca ggacgaagtc ccaggtcccg gacggggctc        60
     tcagggtctc aggctccgag agccttgtct gcattgggga ggcgcagcgt tggggattcc       120
     ccactcccac gagtttcact tcttctccca acctatgtcg ggtccttctt ccaggatact       180
     cgtgacgcgt ccccaattcc cactcccatt gggtgtcggg tgtctagaga agccaatcag       240
     tgtcgccggg gtcccagttc taaagtcccc acgcacccac ccggactcag aatctcctca       300
     gacgccgaga tgcgggtcac ggcgccccga accctcctcc tgctgctctg gggggcagtg       360
     gccctgaccg agacctgggc cggtgagtgc gggatcggga gggaaatggc ctctgtgggg       420
     aggagcgagg ggaccgcagg cgggggcgca ggacccgggg agccgcgccg ggaggagggt       480
     ctggcgggtc tcagcccctc ctggccccca ggctcccact ccatgaggta tttctacacc       540
     gccatgtccc ggcccggccg cggggagccc cgcttcatca ccgtgggcta cgtggacgac       600
     acccagttcg tgaggttcga cagcgacgcc acgagtccga ggatggcgcc ccgggcgcca       660
     tggatagagc aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac       720
     acacagactt accgagagaa cctgcgcacc gcgctccgct actacaacca gagcgaggcc       780
     ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg gacggcccgg       840
     gtcgccccga gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac       900
     cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa       960
     tccccgcggg ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcggggccgg      1020
     ggccagggtc tcacacttgg cagacgatgt atggctgcga cctggggccg gacgggcgcc      1080
     tcctccgcgg gcataaccag ttagcctacg acggcaagga ttacatcgcc ctgaacgagg      1140
     acctgagctc ctggaccgcg gcggacaccg cggctcagat cacccagctc aagtgggagg      1200
     cggcccgtgt ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc      1260
     gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg      1320
     agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga ggaggaaaat      1380
     gggatcagcg ctagaatgtc gccctccctt gaatggagaa tggcatgagt tttcctgagt      1440
     ttcctctgag ggccccctct tctctctagg acaattaagg gatgacgtct ctgaggaaat      1500
     gtaggggaag acagtcccta gaatactgat caggggtccc ctttgacccc tgcagcagcc      1560
     ttgggaaccg tgacttttcc tctcaggcct tgttctctgc ctcacactca gtgtgtttgg      1620
     ggctctgatt ccagcacttc tgagtcactt tacctccact cagatcagga gcagaagtcc      1680
     ctgttccccg ctcagagact cgaactttcc aatgaatagg agattatccc aggtgcctgc      1740
     gtccaggctg gtgtctgggt tctgtgcccc ttccccaccc caggtgtcct gtccattctc      1800
     aggctggtca catgggtggt cctagggtgt cccatgagag atgcaaagcg cctgaatttt      1860
     ctgactcttc ccatcagacc ccccaaagac acacgtgacc caccacccca tctctgacca      1920
     tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg      1980
     gcagcgggat ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg      2040
     agatagaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata      2100
     cacatgccat gtacagcatg aggggctgcc gaagcccctc accctgagat ggggtaagga      2160
     gggggatgag gggtcatatc tcttctcagg gaaagcagga gcccttctgg agcccttcag      2220
     cagggtcagg gcccctcatc ttcccctcct ttcccagagc catcttccca gtccaccgtc      2280
     cccatcgtgg gcattgttgc tggcctggct gtcctagcag ttgtggtcat cggagctgtg      2340
     gtcgctgctg tgatgtgtag gaggaagagc tcaggtaggg aaggggtgag gggtggggtc      2400
     tgggttttct tgtcccactg ggggtttcaa gccccaggta gaagtgttcc ctgcctcatt      2460
     actgggaagc agcatgcaca caggggctaa cgcagactgg gaccctgtgt gccagcactt      2520
     actcttttgt gcagcacatg tgacaatgaa gcacggatgt atcaccttga tggttgtggt      2580
     gttggggtcc tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct      2640
     taggagggca gttggtccag gacccacact tgctttcctc gtgtttcctg atcctgccct      2700
     gggtctgtag tcatacttct ggaaattcct tttgggtcca agactaggag gttcctctaa      2760
     gatctcatgg ccctgcttcc tcccagtccc ctcacaggac attttcttcc cacaggtgga      2820
     aaaggaggga gctactctca ggctgcgtgt aagtggtggg ggtgggagtg tggaggagct      2880
     cacccacccc ataattcctc ctgtcccacg tctcctgcgg gctctgacca ggtcctgttt      2940
     ttgttctact ccaggcagcg acagtgccca gggctctgat gtgtctctca cagcttgaaa      3000
     aggtgagatt cttggggtct agagtgggcg gggggggtgg tggggcagag gggaaaggcc      3060
     tgggtaatgg acattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagagtgt      3120
     catcacttac catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac      3180
     agctgtcttg tgagggaccg agatgcagga tttcttcacg cctccccttt gtgacttcaa      3240
     gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgtgtccc tgttagcata      3300
     atgtgaggag gtggagagac agcccaactg tgtgtccact gtgacccctg ttcccatgct      3360
     gacctgtgtt ct                                                          3372
//


spacer
spacer