Dbfetch

ID   AJ295250; SV 1; linear; genomic DNA; STD; HUM; 817 BP.
XX
AC   AJ295250;
XX
DT   07-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial MICA gene for MHC class I chain-related protein A,
DE   exons 2-3 and joined CDS
XX
KW   MHC class I chain-related protein A; MICA gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-817
RA   Perez-Rodriguez M.E.;
RT   ;
RL   Submitted (13-NOV-2000) to the INSDC.
RL   Perez-Rodriguez M.E., Research Institute, The Anthony Nolan Bone Marrow
RL   Trust, Pond Street, Hampstead, London NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Perez-Rodriguez M., Arguello R., Raimondi E., Marsh S.G.E., Madrigal A.;
RT   "New MICA allele in the Coya American Indian population from north-western
RT   Argentina";
RL   Unpublished.
XX
DR   MD5; daf392099beea247423a34537d1ca2ed.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AJ295250.
XX
CC   Related sequence: AJ295251
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..817
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Argentina:North-Western Argentina"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..255,530..817,AJ295251.1:1..279,
FT                   AJ295251.1:380..>517)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /function="unknown"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*047"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAC88121.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEGHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHAVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAIFVIIIFYVCCCKKKTSAAEGP"
FT   exon            <1..255
FT                   /gene="MICA"
FT                   /number=2
FT   intron          256..529
FT                   /gene="MICA"
FT                   /number=2
FT   exon            530..817
FT                   /gene="MICA"
FT                   /number=3
XX
SQ   Sequence 817 BP; 211 A; 192 C; 268 G; 146 T; 0 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt atctacccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg gaggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ctccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacag                                817
//