spacer

EBI Dbfetch

ID   AJ295141; SV 2; linear; genomic DNA; STD; HUM; 3190 BP.
XX
AC   AJ295141;
XX
DT   29-NOV-2000 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA gene for MHC class I antigen, B*4701 allele, exons 1-7
XX
KW   B*4701 allele; HLA-B gene; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Cox S.T.;
RT   ;
RL   Submitted (27-OCT-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Confirmation of HLA B*4701";
RL   Unpublished.
XX
RN   [3]
RP   1-3190
RA   Cox S.T.;
RT   ;
RL   Submitted (20-MAY-2003) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
DR   MD5; 9b42ff08085b5743718484fcc7dc97db.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3190
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="PLH"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(104..176,306..575,820..1095,1671..1946,2040..2156,
FT                   2598..2630,2737..2780)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="B*4701 allele"
FT                   /db_xref="GOA:P30485"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*47:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30485"
FT                   /protein_id="CAC17463.2"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRT
FT                   LLRYYNQSEAGSHTLQRMFGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVVCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            104..176
FT                   /gene="HLA-B"
FT                   /number=1
FT   intron          177..305
FT                   /gene="HLA-B"
FT                   /number=1
FT   exon            306..575
FT                   /gene="HLA-B"
FT                   /number=2
FT   intron          576..819
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            820..1095
FT                   /gene="HLA-B"
FT                   /number=3
FT   intron          1096..1670
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1671..1946
FT                   /gene="HLA-B"
FT                   /number=4
FT   intron          1947..2039
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2040..2156
FT                   /gene="HLA-B"
FT                   /number=5
FT   intron          2157..2597
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            2598..2630
FT                   /gene="HLA-B"
FT                   /number=6
FT   intron          2631..2736
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            2737..2780
FT                   /gene="HLA-B"
FT                   /number=7
XX
SQ   Sequence 3190 BP; 587 A; 915 C; 1019 G; 669 T; 0 other;
     attgggccct ctagatgcat gctcgagcgg ccgccagtgt gatggatatc tgcagaattc        60
     gcccttgggc gtcgacggac tcagaatctc cccagacgcc gagatgcggg tcacggcgcc       120
     ccgaaccctc ctcctgctgc tctggggggc agtggccctg accgagacct gggctggtga       180
     gtgcggggtc gggagggaaa tggcctctgt ggggaggagc gaggggaccg caggcggggg       240
     ctcaggaccc ggggagccgc gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc       300
     cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg gccgcgggga       360
     gccccgcttc atcaccgtgg gctacgtgga cgacacgctg ttcgtgaggt tcgacagcga       420
     cgccacgagt ccgaggaagg agccgcgggc gccatggata gagcaggagg ggccggagta       480
     ttgggaccgg gagacacaga tctccaagac caacacacag acttaccgag aggacctgcg       540
     gaccctgctc cgctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       600
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       660
     tccgcccccg aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt       720
     ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg       780
     ggctcggggg gacggggctg accgcggggc ctgggccagg gtctcacacc ctccagagga       840
     tgtttggctg cgacgtgggg ccggacgggc gcctcctccg cgggtaccac caggacgcct       900
     acgacggcaa ggattacatc gccctgaacg aggacctgag ctcctggacc gccgcggaca       960
     cggcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag cagctgagag      1020
     cctacctgga gggcgagtgc gtggagtggc tccgcagata cctggagaac gggaaggaga      1080
     cgctgcagcg cgcgggtacc aggggcagtg gggagccttc cccatctcct ataggtcgcc      1140
     ggggatggcc tcccacgaga agaggaggaa aatgggatca gcgctagaat gtcgccctcc      1200
     cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc tcttctctct      1260
     aggacaatta agggatgacg tctctgagga aatggagggg aagacagtcc ctagaatact      1320
     gatcaggggt cccctttgac ccctgcagca gccttgggaa ccgtgacttt tcctctcagg      1380
     ccttgttctc tgcctcacac tcagtgtgtt tggggctctg attccagcac ttctgagtca      1440
     ctttacctcc acttagatca ggagcagaag tccctgttcc ccgctcagag actcgaactt      1500
     tccaatgaat aggagattat cccaggtgcc tgcgtccagg ctggtgtctg ggttctgtgc      1560
     cccttcccca ccccaggtgt cctgtccatt ctcaggctgg tcacatgggt ggtcctaggg      1620
     tgtcccatga gagatgcaaa gcgcctgaat tttctgactc ttcccatcag accccccaaa      1680
     gacacacgtg acccaccacc ccatctctga ccatgaggcc accctgaggt gctgggccct      1740
     gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg accaaactca      1800
     ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga agtgggcagc      1860
     tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc atgaggggct      1920
     gccgaagccc ctcaccctga gatggggtaa ggagggggat gaggggtcat atctcttctc      1980
     agggaaagca ggagcccttc agcagggtca gggcccctca tcttcccttc ctttcccaga      2040
     gccgtcttcc cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc      2100
     agttgtggtc atcggagctg tggtcgctgc tgtggtgtgt aggaggaaga gctcaggtag      2160
     ggaaggggtg aggggtgggg tctgagtttt cttgtcccac tgggggtttc aagccccagg      2220
     tagaagtgtt ccctgcctca ttactgggaa gcagcatcca cacaggggct aacgcagcct      2280
     gggaccctgt gtgccagcac ttactctttt gtgcagcaca tgtgacaatg aaggacggat      2340
     gtatcacctt ggtggttgtg gtgttggggt cctgattcca gcattcatga gtcaggggaa      2400
     ggtccctgct aaggacagac cttaggaggg cagttggtcc aggacccaca cttgctttcc      2460
     tcgtgtttcc tgatcctgcc ttgggtctgt agtcatactt ctggaaattc cttttgggtc      2520
     caagacgagg aggttcctct aagatctcat ggccctgctt cctcccagtc ccctcacagg      2580
     gcattttctt cccacaggtg gaaaaggagg gagctactct caggctgcgt gtaagtgatg      2640
     ggggcgggag tgtggaggag ctcacccacc ccctaattcc tcctgtccca cgtctcctgc      2700
     gggctctgac caggtcctgt ttttgttcta ctccaggcag cgacagtgcc cagggctctg      2760
     atgtgtctct cacagcttga aaaggtgaga ttcttggggt ctagagtggg tggggtggca      2820
     ggtctggggg tgggtggggc agtggggaaa ggcctgggta atggagattc tttgattggg      2880
     atgtttcgcg tgtgtggtgg gctgtttaga ctgtcatcac ttaccatgac taaccagaat      2940
     ttgttcatga ctgttgtttt ctgtagcctg agacagctgt cttgtgaggg actgagatgc      3000
     aggatttctt cacgcctccc ctttgtgact tcaagagcct ctggcatctc tttctgcaaa      3060
     ggcacctgaa tgtgtctgcg tccctgttag cataatgtga ggaggtggag agaccagccc      3120
     acccccgtgt ccactgtgac ccctgttcgc atgctgacct gtgtttcctc cccagaagct      3180
     tgcggaaggg                                                             3190
//


spacer
spacer