Dbfetch

ID   AJ293898; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ293898;
XX
DT   04-SEP-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*1336
DE   allele, exon 2
XX
KW   DRB1*1336 allele; HLA-DRB1; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Guttridge M.G.;
RT   ;
RL   Submitted (01-SEP-2000) to the INSDC.
RL   Guttridge M.G., Tissue Typing, Welsh Blood Service, Ely Valley Road, Talbot
RL   Green, Pontyclun, Cardiff, CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Guttridge M.G., Street J., Darke C.;
RT   "Confirmatory sequence, population genetics and serology of HLA-DRB1*1336";
RL   Unpublished.
XX
DR   MD5; 64fb2015612a15a844155a8abcc829a1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="30638"
FT                   /cell_type="white blood cells"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB1*1336 allele"
FT                   /db_xref="GOA:Q9GIY6"
FT                   /db_xref="IMGT/HLA:DRB1*13:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GIY6"
FT                   /protein_id="CAC07214.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="DRB1*1336 allele"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//