Dbfetch

ID   AJ293725; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ293725;
XX
DT   05-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, exon 2
XX
KW   HLA-DRB1 gene; human leucocyte antigen; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (07-AUG-2000) to the INSDC.
RL   Tiercy J.M., University Hospital of Geneva, Transplantation Immunology
RL   Unit, 24 rue Micheli-du-Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Zanone R., Studer F., Tiercy J.M.;
RT   "Sequence of a new HLA-DR12 allele with two silent substitutions that alter
RT   PCR-SSP typing";
RL   Unpublished.
XX
DR   MD5; 3cc70b5a7bb61eaf946e1bba278686ff.
XX
CC   Related sequence AJ302075
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BS464263"
FT                   /note="Haplotype: HLA-A24,A68; B55,B61;
FT                   DRB1*12new,DRB1*1402; DRB3*0101,DRB3*0202"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB1"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9BD12"
FT                   /db_xref="IMGT/HLA:DRB1*12:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD12"
FT                   /protein_id="CAC28260.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 67 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//