spacer

EBI Dbfetch

ID   AJ293695; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ293695;
XX
DT   03-AUG-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, new DRB1
DE   allele, exon 2 and joined CDS
XX
KW   DRB1 molecule; HLA-DRB1 gene; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wu S.;
RT   ;
RL   Submitted (03-AUG-2000) to the INSDC.
RL   Wu S., Medical Technology, Tzu Chi University, #701, Chung Yang Rd.,
RL   Section III, Hualien, Taiwan, 970, TAIWAN.
XX
RN   [2]
RA   Wu S., Shiao Y.M.;
RT   "A novel HLA-DR12 allele (DRB1*1201new) identified in the aboriginal tribe
RT   members of Taiwan: implication for the generation of both DRB1*1201 and
RT   DRB1*1206 alleles";
RL   Unpublished.
XX
DR   MD5; 60c9d15a0d177aac42976424db91da13.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,AJ293696.1:1..>282)
FT                   /gene="HLA-DRB1"
FT   CDS             join(<1..270,AJ293696.1:1..>282)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /standard_name="MHC class II antigen"
FT                   /product="human leucocyte antigen DRB"
FT                   /function="antigen presentation"
FT                   /note="new allele"
FT                   /db_xref="GOA:Q95IE4"
FT                   /db_xref="IMGT/HLA:DRB1*12:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IE4"
FT                   /protein_id="CAC48395.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="new allele"
XX
SQ   Sequence 270 BP; 55 A; 67 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer