spacer

EBI Dbfetch

ID   AJ293264; SV 1; linear; mRNA; STD; HUM; 1077 BP.
XX
AC   AJ293264;
XX
DT   04-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens mRNA for MHC class I antigen, HLA-E*0101 allele (HLA-E gene)
XX
KW   HLA-E gene; human leucocyte antigen E; major histocompatibility complex;
KW   MHC class I antigen, HLA-E*0101 allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1077
RA   Ulbrecht M.;
RT   ;
RL   Submitted (01-SEP-2000) to the INSDC.
RL   Ulbrecht M., Institute of Anthropology and Human Genetics,
RL   Ludwig-Maximilians-University Munich, Richard-Wagner Str. 10/I, 80333
RL   Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1002/(SICI)1521-4141(199902)29:02<537::AID-IMMU537>3.0.CO;2-6.
RX   PUBMED; 10064069.
RA   Ulbrecht M., Courturier A., Martinozzi S., Pla M., Srivastava R.,
RA   Peterson P.A., Weiss E.H.;
RT   "Cell surface expression of HLA-E: interaction with human
RT   beta2-microglobulin and allelic differences";
RL   Eur. J. Immunol. 29(2):537-547(1999).
XX
DR   MD5; 79d384e735c5aefc3724c6696ab69a6f.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   H-InvDB; HIT000246613_04.4.
DR   H-InvDB; HIT000246613_05.4.
DR   H-InvDB; HIT000246613_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1077
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A2, -B5, -Cw1"
FT                   /cell_line="721.45"
FT                   /cell_type="B-LCL"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1077
FT                   /gene="HLA-E"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="HLA-E*0101 allele"
FT                   /db_xref="GOA:P13747"
FT                   /db_xref="H-InvDB:HIT000246613_03.4"
FT                   /db_xref="HGNC:HGNC:4962"
FT                   /db_xref="IMGT/HLA:E*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1KPR"
FT                   /db_xref="PDB:1KTL"
FT                   /db_xref="PDB:1MHE"
FT                   /db_xref="PDB:2ESV"
FT                   /db_xref="PDB:3AM8"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13747"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC07213.1"
FT                   /translation="MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRG
FT                   YYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
FT   sig_peptide     1..63
FT                   /gene="HLA-E"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   mat_peptide     64..1074
FT                   /gene="HLA-E"
FT                   /product="MHC class I antigen"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 1077 BP; 220 A; 315 C; 350 G; 192 T; 0 other;
     atggtagatg gaaccctcct tttactcctc tcggaggccc tggcccttac ccagacctgg        60
     gcgggctccc actccttgaa gtatttccac acttccgtgt cccggcccgg ccgcggggag       120
     ccccgcttca tctctgtggg ctacgtggac gacacccagt tcgtgcgctt cgacaacgac       180
     gccgcgagtc cgaggatggt gccgcgggcg ccgtggatgg agcaggaggg gtcagagtat       240
     tgggaccggg agacacggag cgccagggac accgcacaga ttttccgagt gaacctgcgg       300
     acgctgcgcg gctactacaa tcagagcgag gccgggtctc acaccctgca gtggatgcat       360
     ggctgcgagc tggggcccga caggcgcttc ctccgcgggt atgaacagtt cgcctacgac       420
     ggcaaggatt atctcaccct gaatgaggac ctgcgctcct ggaccgcggt ggacacggcg       480
     gctcagatct ccgagcaaaa gtcaaatgat gcctctgagg cggagcacca gagagcctac       540
     ctggaagaca catgcgtgga gtggctccac aaatacctgg agaaggggaa ggagacgctg       600
     cttcacctgg agcccccaaa gacacacgtg actcaccacc ccatctctga ccatgaggcc       660
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcag       720
     gatggggagg gccataccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga       780
     accttccaga agtgggcagc tgtggtggtg ccttctggag aggagcagag atacacgtgc       840
     catgtgcagc atgaggggct acccgagccc gtcaccctga gatggaagcc ggcttcccag       900
     cccaccatcc ccatcgtggg catcattgct ggcctggttc tccttggatc tgtggtctct       960
     ggagctgtgg ttgctgctgt gatatggagg aagaagagct caggtggaaa aggagggagc      1020
     tactctaagg ctgagtggag cgacagtgcc caggggtctg agtctcacag cttgtaa         1077
//


spacer
spacer