spacer

EBI Dbfetch

ID   AJ292971; SV 1; linear; genomic DNA; STD; HUM; 1953 BP.
XX
AC   AJ292971;
XX
DT   16-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B*27 gene for MHC class I antigen, exons 1-4
XX
KW   HLA-B*27 gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1953
RA   Witter K.;
RT   ;
RL   Submitted (11-AUG-2000) to the INSDC.
RL   Witter K., University of Munich, Labor of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Zahn R., Scholz S., Albert E.D.;
RT   "Identification of a novel B*27 allele from a Filipino cell";
RL   Unpublished.
XX
DR   MD5; 7c00ea4a13a15f23ea8fa801fe390b19.
XX
CC   exon 1 and exon 2 identical to HLA-B*2704 and HLA-B*2706,
CC   exon 3 identical to HLA-B*2706, exon 4 identical to HLA-B*2704"
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1953
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   regulatory      <1..57
FT                   /regulatory_class="promoter"
FT   mRNA            join(58..130,259..528,773..1048,1624..>1899)
FT                   /gene="HLA-B*27"
FT   CDS             join(58..130,259..528,773..1048,1624..>1899)
FT                   /gene="HLA-B*27"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q9GJF1"
FT                   /db_xref="IMGT/HLA:B*27:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJF1"
FT                   /protein_id="CAC03611.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDRESLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPGEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            58..130
FT                   /gene="HLA-B*27"
FT                   /number=1
FT   intron          131..258
FT                   /gene="HLA-B*27"
FT                   /number=1
FT   exon            259..528
FT                   /gene="HLA-B*27"
FT                   /number=2
FT   intron          529..772
FT                   /gene="HLA-B*27"
FT                   /number=2
FT   exon            773..1048
FT                   /gene="HLA-B*27"
FT                   /number=3
FT   intron          1049..1623
FT                   /gene="HLA-B*27"
FT                   /number=3
FT   exon            1624..>1899
FT                   /gene="HLA-B*27"
FT                   /number=4
XX
SQ   Sequence 1953 BP; 372 A; 607 C; 642 G; 332 T; 0 other;
     cccagttcta aagtccccac gcacccaccc ggactcagaa tctcctcaga cgccgagatg        60
     cgggtcacgg cgccccgaac cctcctcctg ctgctctggg gggcagtggc cctgaccgag       120
     acctgggctg gtgagtgcgg ggtcggcagg gaaatggcct ctgtggggag gagcgagggg       180
     accgcaggcg ggggcgcagg acccggggag ccgcgccggg aggagggtcg gcgggtctca       240
     gcccctcctc gcccccaggc tcccactcca tgaggtattt ccacacctcc gtgtcccggc       300
     ccggccgcgg ggagccccgc ttcatcaccg tgggctacgt ggacgacacg ctgttcgtga       360
     ggttcgacag cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg       420
     aggggccgga gtattgggac cgggagacac agatctgcaa ggccaaggca cagactgacc       480
     gagagagcct gcggaccctg ctccgctact acaaccagag cgaggccggt gagtgacccc       540
     ggcccggggc gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc       600
     tccgggtccg agatccgccc ccgaggccgc gggacccgcc cagaccctcg accggcgaga       660
     gccccaggcg cgtttacccg gtttcatttt cagttgaggc caaaatcccc gcgggttggt       720
     cggggcgggg cggggctcgg ggggacgggg ctgaccgcgg ggccggggcc agggtctcac       780
     accctccaga atatgtatgg ctgcgacgtg gggccggacg ggcgcctcct ccgcgggtat       840
     gaccagtacg cctacgacgg caaggattac atcgccctga acgaggacct gagctcctgg       900
     accgccgcgg acacggcggc tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg       960
     gagcagctga gagcctacct ggagggcgag tgcgtggagt ggctccgcag atacctggag      1020
     aacgggaagg agacgctgca gcgcgcgggt accaggggca gtggggagcc ttccccatct      1080
     cctataggtc gccggggatg gcctcccacg agaagaggag gaaaatggga tcagcgctag      1140
     aatgtcgccc tcccttgaat ggagaatggc atgagttttc ctgagtttcc tctgagggcc      1200
     ccctcttctc tctaggacaa ttaagggatg acgtctctga ggaaatggag gggaagacag      1260
     tccctagaat actgatcagg ggtccccttt gacccctgca gcagccttgg gaaccgtgac      1320
     ttttcctctc aggccttgtt ctctgcctca cactcagtgt gtttggggct ctgattccag      1380
     cacttctgag tcactttacc tccactcaga tcaggagcag aagtccctgt tccccgctca      1440
     gagactcgaa ctttccaatg aataggagat tatcccaggt gcctgcgtcc aggctggtgt      1500
     ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc attctcaggc tggtcacatg      1560
     ggtggtccta gggtgtccca tgagagatgc aaagcgcctg aattttctga ctcttcccat      1620
     cagacccccc aaagacacac gtgacccacc accccatctc tgaccatgag gccaccctga      1680
     ggtgctgggc cctgggcttc taccctgggg agatcacact gacctggcag cgggatggcg      1740
     aggaccaaac tcaggacact gagcttgtgg agaccagacc agcaggagat agaaccttcc      1800
     agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacaca tgccatgtac      1860
     agcatgaggg gctgccgaag cccctcaccc tgagatgggg taaggagggg gatgaggggt      1920
     catatctctt ctcagggaaa gcaggagccc ttc                                   1953
//


spacer
spacer