Dbfetch

ID   AJ292564; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ292564;
XX
DT   27-JUL-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial DRB4* gene for DR53 variant, exon 2
XX
KW   DR53 variant; HLA-DRB4 gene; human leucocyte antigen DRB4;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Dunn P.P.;
RT   ;
RL   Submitted (26-JUL-2000) to the INSDC.
RL   Dunn P.P., National Blood Service, H & I Reference Laboratory, Southmead
RL   Hospital, Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Fasano E.;
RT   "Novel DRB4* allele identified by SSOP and SBT";
RL   Unpublished.
XX
DR   MD5; caaa35710cec649ae7bdd8b510222fc5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="HLA-DRB4*"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB4* variant allele"
FT                   /standard_name="MHC class II antigen"
FT                   /product="DR53 variant"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9NQ54"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9NQ54"
FT                   /protein_id="CAC00534.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB4*"
FT                   /number=2
XX
SQ   Sequence 270 BP; 65 A; 61 C; 96 G; 48 T; 0 other;
     cacgtttctt ggagcaggct aagtgtgagt gtcatttcct caatgggacg gagcgagtgt        60
     ggaacctgat cagatacatc tataaccaag aggagtacgc gcgctacaac agtgatctgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagatac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//