Dbfetch

ID   AJ292253; SV 1; linear; genomic DNA; STD; HUM; 3139 BP.
XX
AC   AJ292253;
XX
DT   12-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele B*4006new, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*4006new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3139
RA   Cox S.T.;
RT   ;
RL   Submitted (10-JAN-2001) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T., Mcwhinnie A.J., Little A.M.;
RT   "New HLA sequences with intron 2 differences";
RL   Unpublished.
XX
RN   [3]
RA   Cox S.T.;
RT   "Variant B*4006 with difference in exon 2";
RL   Unpublished.
XX
DR   MD5; 8fc05452bdf9a82676fb70d3e890cc4c.
XX
CC   Related sequence: AJ300180.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3139
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,203..472,716..991,1567..1842,1936..2052,
FT                   2494..2526,2633..2676)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="allele B*4006new"
FT                   /db_xref="GOA:Q04826"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*40:06:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:5IEH"
FT                   /db_xref="PDB:5IEK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04826"
FT                   /protein_id="CAC29021.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="allele B*4006new"
FT   intron          74..202
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="allele B*4006new"
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="allele B*4006new"
FT   intron          473..715
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="allele B*4006new"
FT   misc_difference 687
FT                   /replace="ag"
FT                   /note="AJ292253 differs from B*4006 (AJ300180)in intron 2"
FT                   /note="conflict"
FT                   /citation=[3]
FT   exon            716..991
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="allele B*4006new"
FT   intron          992..1566
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="allele B*4006new"
FT   exon            1567..1842
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="allele B*4006new"
FT   intron          1843..1935
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="allele B*4006new"
FT   exon            1936..2052
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="allele B*4006new"
FT   intron          2053..2493
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="allele B*4006new"
FT   exon            2494..2526
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="allele B*4006new"
FT   intron          2527..2632
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="allele B*4006new"
FT   exon            2633..2676
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="allele B*4006new"
XX
SQ   Sequence 3139 BP; 582 A; 897 C; 1004 G; 656 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagaga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc       600
     gagagcccca ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt       660
     tggtcggggc ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct       720
     cacacttggc agacgatgta tggctgcgac gtggggccgg acgggcgcct cctccgcggg       780
     cataaccagt acgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc       840
     tggaccgccg cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg       900
     gcggagcagc tgagagccta cctggagggc gagtgcgtgg agtggctccg cagatacctg       960
     gagaacggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca      1020
     tctcctatag gtcgccgggg atggcctccc acgagaagag gaggaaaatg ggatcagcgc      1080
     tagaatgtcg ccctcccttg aatggagaat ggcatgagtt ttcctgagtt tcctctgagg      1140
     gccccctctt ctctctagga caattaaggg atgacgtctc tgaggaaatg gaggggaaga      1200
     cagtccctag aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccgt      1260
     gacttttcct ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc      1320
     cagcacttct gagtcacttt acctccactc agatcaggag cagaagtccc tgttccccgc      1380
     tcagagactc gaactttcca atgaatagga gattatccca ggtgcctgcg tccaggctgg      1440
     tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg tccattctca ggctggtcac      1500
     atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc      1560
     catcagaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1620
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcccctca ccctgagatg gggtaaggag ggggatgagg      1860
     ggtcatatct cttctcaggg aaagcaggag cccttcagca gggtcagggc ccctcatctt      1920
     cccttccttt cccagagccg tcttcccagt ccaccgtccc catcgtgggc attgttgctg      1980
     gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga      2040
     ggaagagctc aggtagggaa ggggtgaggg gtggggtctg agttttcttg tcccactggg      2100
     ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggaagcag catccacaca      2160
     ggggctaacg cagcctggga ccctgtgtgc cagaacttac tcttttgtgc agcacatgtg      2220
     acaatgaagg acggatgtat caccttggtg gttgtggtgt tggggtcctg attccagcat      2280
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tggtccagga      2340
     cccacacttg ctttcctcgt gtttcctgat cctgccttgg gtctgtagtc atacttctgg      2400
     aaattccttt tgggtccaag acgaggaggt tcctctaaga tctcatggcc ctgcttcctc      2460
     ccagtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tactctcagg      2520
     ctgcgtgtaa gtgatggggg tgggagtgtg gaggagctca cccaccccct aattcctcct      2580
     gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc aggcagcgac      2640
     agtgcccagg gctctgatgt gtctctcaca gcttgaaaag gtgagattct tggggtctag      2700
     agtgggtggg gtggcaggtc tgggggtggg tggggcagtg gggaaaggcc tgggtaatgg      2760
     agattctttg attgggatgt ttcgcgtgtg tggtgggctg tttagactgt catcacttac      2820
     catgactaac cagaatttgt tcatgactgt tgttttctgt agcctgagac agctgtcttg      2880
     tgagggactg agatgcagga tttcttcacg cctccccttt gtgacttcaa gagcctctgg      2940
     catctctttc tgcaaaggca cctgaatgtg tctgcgtccc tgttagcata atgtgaggag      3000
     gtggagagac cagcccaccc ccgtgtccac tgtgacccct gttcgcatgc tgacctgtgt      3060
     ttcctcccca gaagcttgcg gaagggcgaa ttccagcaca ctggcggccg ttactagtgg      3120
     atccgagctc ggtaccaag                                                   3139
//