Dbfetch

ID   AJ292074; SV 1; linear; genomic DNA; STD; HUM; 468 BP.
XX
AC   AJ292074;
XX
DT   02-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC Class II antigen, exon 2
XX
KW   HLA-DPB1 gene; major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-468
RA   Bengtsson M.;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   Bengtsson M., DEPT OF ONCOLOGY, RADIOLOGY AND CLINICAL IMMUNOLOGY, Section
RL   of Clinical Immunology, Rudbeck Laboratory, University Hospital, SE-751 85
RL   UPPSALA, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new HLA DPB1 variant in an unrelated bone marrow donor";
RL   Unpublished.
XX
DR   MD5; 7d6f23a11bdb8628c194a5014cc9193c.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..468
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <86..>349
FT                   /gene="HLA-DPB1"
FT                   /product="MHC Class II antigen"
FT   CDS             <86..>349
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC Class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*90:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAC27995.1"
FT                   /translation="NYVYQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRR"
FT   exon            <86..>349
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 468 BP; 102 A; 117 C; 178 G; 71 T; 0 other;
     aagaatcgtt aatattgaga gagagaggga gaaagaggat tagatgagag tggcgcctcc        60
     gctcatgtcc gccccctccc cgcagagaat tacgtgtacc agggacggca ggaatgctac       120
     gcgtttaatg ggacacagcg cttcctggag agatacatct acaaccggga ggagttcgcg       180
     cgcttcgaca gcgacgtggg ggagttccgg gcggtgacgg agctggggcg gcctgctgcg       240
     gagtactgga acagccagaa ggacatcctg gaggagaagc gggcagtgcc ggacagggta       300
     tgcagacaca actacgagct ggacgaggcc gtgaccctgc agcgccgagg tagtgagggc       360
     tttgggccgg cggtcccagg gcagccccgc gggcccgtgc ccagggcgca ggagcagccg       420
     ggttggccta agggacctta gtgccgggcg gaaaggggac tttgggtt                    468
//