Dbfetch

ID   AJ291815; SV 1; linear; genomic DNA; STD; HUM; 3209 BP.
XX
AC   AJ291815;
XX
DT   19-DEC-2000 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-Cw gene for MHC class I antigen, Cw*0704 allele, exons 1-8
XX
KW   HLA-Cw gene; HLA-Cw*0704 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3209
RA   Cox S.T.;
RT   ;
RL   Submitted (15-DEC-2000) to the INSDC.
RL   Cox S.T., Dept of HLA Sequencing, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of HLA-Cw*0704 confirmed";
RL   Unpublished.
XX
DR   MD5; bbaf6c4512759e916ca28289c83e84ea.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
CC   Related sequences: D49552, X83394.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3209
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,204..473,724..999,1587..1862,1987..2106,
FT                   2547..2579,2687..2734,2899..2903)
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /note="Cw*0704 allele"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="CAC19191.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQDRAYLEGTCVEWLRRYLENGKKTLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="Cw*0704 allele"
FT   intron          74..203
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="Cw*0704 allele"
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*0704 allele"
FT   intron          474..723
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="Cw*0704 allele"
FT   exon            724..999
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*0704 allele"
FT   intron          1000..1586
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="Cw*0704 allele"
FT   exon            1587..1862
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="Cw*0704 allele"
FT   intron          1863..1986
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="Cw*0704 allele"
FT   exon            1987..2106
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="Cw*0704 allele"
FT   intron          2107..2546
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="Cw*0704 allele"
FT   exon            2547..2579
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="Cw*0704 allele"
FT   intron          2580..2686
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="Cw*0704 allele"
FT   exon            2687..2734
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="Cw*0704 allele"
FT   intron          2735..2898
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="Cw*0704 allele"
FT   exon            2899..2903
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="Cw*0704 allele"
XX
SQ   Sequence 3209 BP; 601 A; 935 C; 1003 G; 670 T; 0 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctgtgagtg cggggttggg agggaagcgg cctctgcgga gaggagcgag       120
     gggccctccc ggcgagggcg caggacccgg ggagccgcgc agggaggtgg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttcgaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccccgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc cccgtctgag atccacccca aggtggatct gcggaacccg cccagaccct       600
     cgaccggaga gagccccagt cgcctttacc cggtttcatt ttcggtttag gccaaaatcc       660
     ccgcgggttg gtcggggcgg ggcggggctc gggggactgg gctgaccgcg ggggcggggc       720
     cagggtctca caccttccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       780
     tccgcgggta tgaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc       840
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg       900
     cccgtgcggc ggagcaggac agagcctacc tggagggcac gtgcgtggag tggctccgca       960
     gatacctgga gaacgggaag aagacgctgc agcgcgcggg taccaggggc agtggggagc      1020
     cttccccatc tcctatagat ctcccgggat ggcctcccac gaggagggga ggaaaatggg      1080
     atcagcactg gaatatcgcc ctcccttgaa tggagaatgg catgagtttt cctgagtttc      1140
     ctctgagggc cccctctgct ctctaggaca attaagggat gaagtctctg aggaaatgga      1200
     ggggaagaca gtccctggaa tactgatcag gggtctcctt tgaccacttt gaccactgca      1260
     gcagctgtgg tcaggctgct gacctttctc tcaggccttg ttctctgcct cacactcaat      1320
     gtgtctgaag gtttgattcc agcttttctg agtcctgcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcctccct cagagactag aactttccaa tgaataggag attatcccag      1440
     gtgcctgtgt ccaggctggc gtctgggttc tgtgccgcct tccccacccc aggtgtcctg      1500
     tccattctca ggatggtcac atgggcgctg ctggagtgtc ccaagagaga tgcaaagtgt      1560
     ctgaattttc tgactcttcc cgtcagaacc cccaaagaca cacgtgaccc accaccccct      1620
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1680
     actgacctgg cagcgggatg gggaggacca gacccaggac accgagcttg tggagaccag      1740
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggacaaga      1800
     gcagagatac acgtgccata tgcagcacga ggggctgcaa gagcccctca ccctgagctg      1860
     gggtaaggag gggaatgggg ggtcacatct cttatcagag aaagcagaag tccttctgga      1920
     gcccttcagc cgggtcaggg ctgaggcttg ggggtcaggg cccctcacct tctcctcctt      1980
     tcccagagcc atcttcccag cccaccatcc ccatcatggg catcgttgct ggcctggctg      2040
     tcctggttgt cctagctgtc cttggagctg tggtcaccgc tatgatgtgt aggaggaaga      2100
     gctcaggtag ggaaggggtg aagagcgggg tctgggtttt cttgtcccac tgggagtttc      2160
     aagccccagg tagaagtgtg ccccgccttg ttactggaag caccatccac acatgggcca      2220
     tcccagcctg ggaccctgtg tgccagcact tactcttttg tgaagcacat gtgacaatga      2280
     aggacggatg tatcaccttg atgattatgg tgttggggtc ctgattccag cattcatgag      2340
     tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca gaacccacag      2400
     ctgctttccc catgtttcct gatcctgccc tgggtctgca gtcgtagttc tggaaacttc      2460
     tcttgggtcc aagactagga ggttccccta agatcacatg gccctgcctc ctcccagtcc      2520
     cctcataggg cattttcttc ccacaggtgg aaaaggaggg agctgctctc aggctgcgtg      2580
     taagtgatgg cggcgggcgt gtggaggagc tcacctactc cataattcct cttgtcccac      2640
     atctcctgcg ggctctgacc aggtcttttt ttttgttcta ccccaggcag caacagtgcc      2700
     cagggctctg atgagtctct catcacttgt aaaggtgaga ttctggggag ctgaagtggt      2760
     cgggggtggg gcagagggaa aaggcctggg taatggggat tctttgattg ggacgtttcg      2820
     agtgtgtggt gggccgttca gagtgtcatc acttaccatg actgacctga atttgttcat      2880
     gactattgtg ttctgtagcc tgagacagct gcctgtgtgg gactgagatg caggatttct      2940
     tcacacctct cctttgtgac ttcaagagcc tctggcatct ctttctgcaa aggcatctga      3000
     atgtgtctgc gttcctgtta gcataatgtg aggaggtgga gagacagccc acccccgtgt      3060
     ccaccgtgac ccctgtcccc acactgacct gtgttccctc cccgaaagct tgcggaaggg      3120
     cgaattccag cacactggcg gccgttacta gtggatccga gctcggtacc aagcttgatg      3180
     catagcttga gtattctaac gcgtcgcct                                        3209
//