spacer

EBI Dbfetch

ID   AJ291697; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ291697;
XX
DT   25-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens partial HLA-A gene for MHC Class I antigen, HLA-A*0249 allele,
DE   isolate 22697, exon 2 and joined CDS
XX
KW   HLA-A gene; HLA-A*0249 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (03-NOV-2000) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., Gervais T., van den Berg-Loonen E.M.;
RT   "New HLA-A alleles detected by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; b3b396efcbdff42792f12fe9d097192e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="22697"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ291698.1:1..276,AJ495758.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0249"
FT                   /product="MHC Class I antigen"
FT                   /db_xref="GOA:Q9BD14"
FT                   /db_xref="IMGT/HLA:A*02:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD14"
FT                   /protein_id="CAC27240.2"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPEGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0249"
FT                   /number=2
XX
SQ   Sequence 270 BP; 53 A; 82 C; 96 G; 39 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer