Dbfetch

ID   AJ290949; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ290949;
XX
DT   25-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for human leucocyte antigen B, exon 2 and
DE   joined CDS, isolate ZFI
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (14-AUG-2000) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., Hepkema B., Lems S., van den Berg-Loonen E.M.;
RT   "New HLA-B gene identified by sequence based typing";
RL   Unpublished.
XX
DR   MD5; b590aef5e44bc2387fec38bbae861700.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="ZFI"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,AJ290950.1:1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /standard_name="MHC class I antigen"
FT                   /product="human leucocyte antigen B"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*40:35:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BD16"
FT                   /protein_id="CAC27238.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 87 C; 88 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//