spacer

EBI Dbfetch

ID   AJ290395; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ290395;
XX
DT   27-JAN-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DR gene for MHC class II antigen, DRB3* allele,
DE   exon 2
XX
KW   HLA-DR gene; HLA-DRB3* allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Moine A.;
RT   ;
RL   Submitted (25-JAN-2001) to the INSDC.
RL   Moine A., Histocompatibility, EFS Rhone Alpes, BP35, 38701 LA TRONCHE
RL   cedex, FRANCE.
XX
RN   [2]
RA   Moine A.;
RT   "A new HLA DRB3* allele very similar to DRB3*02021 and DRB3*0212 alleles";
RL   Unpublished.
XX
DR   MD5; 74179347323f4d9f02426d4052c72d4b.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="France"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DR"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="DRB3* allele"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="CAC27417.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVAESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DR"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 99 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttgctgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer