spacer

EBI Dbfetch

ID   AJ290394; SV 2; linear; mRNA; STD; HUM; 822 BP.
XX
AC   AJ290394;
XX
DT   27-JAN-2001 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial mRNA for MHC class I antigen (HLA-A gene), HLA-A*26
DE   allele
XX
KW   HLA-A gene; HLA-A*26 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Moine A.;
RT   ;
RL   Submitted (25-JAN-2001) to the INSDC.
RL   Moine A., Histocompatibility, EFS Rhone Alpes, BP35, 38701 LA TRONCHE
RL   cedex, FRANCE.
XX
RN   [2]
RA   Moine A.;
RT   "A new variant form of a HLA A*2607 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-822
RA   Moine A.;
RT   ;
RL   Submitted (18-AUG-2003) to the INSDC.
RL   Moine A., Histocompatibility, EFS Rhone Alpes, BP35, 38701 LA TRONCHE
RL   cedex, FRANCE.
XX
DR   MD5; 03f7de169845f743f1ef5d2f359d35c4.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /country="France"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P30450"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*26:07:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30450"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAC27416.2"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 167 A; 247 C; 289 G; 119 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gttctcacac catccagagg atgtatggct       300
     gcgacgtggg gccggacggg cgcttcctcc gcgggtacca gcaggacgct tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gagacggccc atgaggcgga gcagtggaga gcctacctgg       480
     agggccggtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacggacgc ccccaagacg catatgactc accacgctgt ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgagc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gggaggacca gacccaggac acggagctcg tggagaccag gcctgcaggg gatgggacct       720
     tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga gcagagatac acctgccatg       780
     tgcagcatga gggtctgccc aagcccctca ccctgagatg gg                          822
//


spacer
spacer