Dbfetch

ID   AJ278944; SV 1; linear; genomic DNA; STD; HUM; 3375 BP.
XX
AC   AJ278944;
XX
DT   04-SEP-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen (HLA-B*4501 variant
DE   allele), exons 1-7
XX
KW   HLA-B gene; HLA-B*4501 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3375
RA   Dunn P.P.;
RT   ;
RL   Submitted (03-SEP-2000) to the INSDC.
RL   Dunn P.P., H & I Reference Laboratory, National Blood Service, Southmead
RL   Hospital, Southmead Road, Westbury-on-Trym, Bristol, BS10 5ND, UNITED
RL   KINGDOM.
XX
RN   [2]
RA   Carey K., Green A., Dunn P.P.;
RT   "The complete nucleotide sequence of a variant HLA-B*4501 allele";
RL   Unpublished.
XX
DR   MD5; 75a86344ea80df61f6d0354faffdaf9a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3375
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(311..383,512..781,1033..1308,1883..2158,2263..2379,
FT                   2821..2853,2960..3003)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presinging molecule"
FT                   /note="B*4501 variant allele"
FT                   /db_xref="GOA:P30483"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*45:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30483"
FT                   /protein_id="CAC07211.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   sig_peptide     311..383
FT                   /gene="HLA-B"
FT                   /note="B*4501 variant allele"
FT   exon            311..383
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4501 variant allele"
FT   intron          384..511
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="B*4501 variant allele"
FT   mat_peptide     join(512..781,1033..1308,1883..2158,2263..2379,2821..2853,
FT                   2960..3000)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="B*4501 variant allele"
FT   exon            512..781
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4501 variant allele"
FT   intron          782..1032
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="B*4501 variant allele"
FT   exon            1033..1308
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4501 variant allele"
FT   intron          1309..1882
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="B*4501 variant allele"
FT   exon            1883..2158
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4501 variant allele"
FT   intron          2159..2262
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="B*4501 variant allele"
FT   exon            2263..2379
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4501 variant allele"
FT   intron          2380..2820
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="B*4501 variant allele"
FT   exon            2821..2853
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4501 variant allele"
FT   intron          2854..2959
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="B*4501 variant allele"
FT   exon            2960..3003
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="B*4501 variant allele"
XX
SQ   Sequence 3375 BP; 625 A; 981 C; 1066 G; 703 T; 0 other;
     caagaggctt ggtgtaggag aagagggatc aggacgaagt cccaggcccc gggcggggct        60
     ctcagggtct caggctccga gggccgcgtc tgcaatgggg aggcgcagcg ttggggattc       120
     cccactccca cgagtttcac ttcttctccc aacctatgtc gggtccttct tccaggatac       180
     tcgtgacgcg tccccatttc ccactcccat tgggtgtcgg gtgtctagag aagccaatca       240
     gcgtcgccgt ggtcccagtt ctaaagtccc cacgcaccca cccggactca gaatctcctc       300
     agacgccgag atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct       360
     ggccctgacc gagacctggg ccggtgagtg cgggtcggca gggaaatggc ctctgtgggg       420
     aggagcgagg ggaccgcagg cgggggcgca ggacccgggg agccgcgccg ggaggagggt       480
     cgggcgggtc tcagcccctc ctcgccccca ggctcccact ccatgaggta tttccacacc       540
     gccatgtccc ggcccggccg cggggagccc cgcttcatca ccgtgggcta cgtggacgac       600
     acgctgttcg tgaggttcga cagcgacgcc acgagtccga ggaaggagcc gcgggcgcca       660
     tggatagagc aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac       720
     acacagactt accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc       780
     ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg       840
     gtcgccccga gtctccgggt ccgagatccg cccccctgag gccgcgggac ccgcccagac       900
     cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa       960
     tcccccgcgg ttggtcgggg cggggcgggg cggggctcgg gggacggggc tgacccgcgg      1020
     ggcctgggcc agggtctcac acttggcaga ggatgtatgg ctgcgacctg gggcccgacg      1080
     ggcgcctcct ccgcgggtat aaccagttag cctacgacgg caaggattac atcgccctga      1140
     acgaggacct gagctcctgg accgcggcgg acaccgcggc tcagatcacc cagcgcaagt      1200
     gggaggcggc ccgtgtggcg gagcaggaca gagcctacct ggagggcctg tgcgtggagt      1260
     ggctccgcag atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca      1320
     gtggggagcc ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggag      1380
     gaaaatggga tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc      1440
     ctgagtttcc tctgagggcc ccctcttctc tctaggacaa ttaagggatg acgtctctga      1500
     ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca      1560
     gcagccttgg gaaccgtgac tttcctctca ggccttgttc tctgcctcac actcagtgtg      1620
     tttggggctc tgattccagc acttctgagt cactttacct ccactcagat cgggagcaga      1680
     agtccctgtt ccccgctcag agactcgaac tttccaatga ataggagatt atcccaggtg      1740
     cctgcgtcca ggctggtgtc tgggttctgt gccccttccc caccccaggt gtcctgtcca      1800
     ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat gagagatgca aagcgcctga      1860
     attttctgac tcttcccatc agacccccca aagacacatg tgacccacca ccccatctct      1920
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1980
     acctggcagc gggatggcga ggaccaaact caggacaccg agcttgtgga gaccagacca      2040
     gcaggagata gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      2100
     agatacacat gccatgtaca gcatgagggg ctgccgaagc ccctcaccct gagatggggt      2160
     aaggaggggg atgaggggtc atatctgttc tcagggaaag caggagccct tctggagccc      2220
     ttcagcaggg tcagggcccc tcatcttccc ctcctttccc agagccatct tcccagtcca      2280
     ccatccccat cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag      2340
     ctgtggtcgc tactgtgatg tgtaggagga agagctcagg tagggaaggg gtgaggggtg      2400
     gggtctgggt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt gttccctgcc      2460
     tcattactgg gaagcagcat ccacacaggg gctaacgcag cctgggaccc tgtgtgccag      2520
     cacttactct tttgtgcagc acatgtgaca atgaaggacg gatgtatcgc cttgatggtt      2580
     gtggtgttgg ggtcctgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca      2640
     gaccttagga gggcagttgg tccaggaccc acacttgctt tcctcgtgtt tcctgatcct      2700
     gccttgggtc tgtagtcata cttctggaaa ttccttttgg ttccaagacg aggaggttcc      2760
     tctaagatct catggccctg cttcctccca gtcccctcac aggacatttt cttcccacag      2820
     gtggaaaagg agggagctac tctcaggctg cgtgtaagtg gtgggggtgg gagtgtggag      2880
     gagctcaccc accccataat tcctcctgtc ccacgtctcc tgagggctct gaccaggtcc      2940
     tgtttttgtt ctactccagc cagcgacagt gcccagggct ctgatgtgtc tctcacagct      3000
     tgaaaaggtg agattcttgg ggtctagagt gggtggggtg gcgggtctgg gggtgggtgg      3060
     ggcagtgggg aaaggcctgg gtaatggaga ttctttgatt gggatgtttc gcgtgtgtgg      3120
     tgggctgttc agagtgtcat cacttaccat gactaaccag aatttgttca tgactgttgt      3180
     tttctgtagc ctgagacagc tgtcttgtga gggactgaga tgcaggattt cttcacgcct      3240
     cccctttgtg acttcaagag cctctggcat ctctttctgc aaaggcacct gaatgtgtct      3300
     gcgtccctgt tagcataatg tgaggaggtg gagagacagc ccacccttgt gtccactgtg      3360
     acccctgtcc catgc                                                       3375
//